PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PGSC0003DMP400042874

Common Name

LOC102604033

Organism

Solanum tuberosum

Taxonomic ID

4113

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

NF-YB

Protein Properties

Length: 139aa MW: 15994 Da PI: 4.6543

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PGSC0003DMP400042874	genome	PGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	150.2	4.2e-47	3	96	2	95
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92 eq +++Pianv+rimk++lP akisk+aket+qec+sefisfvt+easdkcq+e+r+t+ngdd++wal++lGf++y+e + yl k r+ PGSC0003DMP400042874 3 DEQVKLVPIANVGRIMKQILPPTAKISKEAKETMQECASEFISFVTGEASDKCQKENRRTVNGDDICWALSSLGFDNYAEVMLRYLYKLRD 93 58899************************************************************************************** PP NF-YB 93 leg 95 +e+ PGSC0003DMP400042874 94 FER 96 *98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	2.2E-44	2	119	IPR009072	Histone-fold
Pfam	PF00808	2.0E-26	9	72	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
SuperFamily	SSF47113	9.83E-35	9	124	IPR009072	Histone-fold
PRINTS	PR00615	1.1E-16	36	54	No hit	No description
PROSITE pattern	PS00685	0	39	55	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	1.1E-16	55	73	No hit	No description
PRINTS	PR00615	1.1E-16	74	92	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 139 aa Download sequence Send to blast
MVDEQVKLVP IANVGRIMKQ ILPPTAKISK EAKETMQECA SEFISFVTGE ASDKCQKENR 60 RTVNGDDICW ALSSLGFDNY AEVMLRYLYK LRDFERVRAN QNKLGLNEDD EDNRDDEEAP 120 SAPLEFNIME RVQRRRFN*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	1e-37	2	93	1	92	Transcription factor HapC (Eurofung)
4g92_B	1e-37	2	93	1	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PGSC0003DMP400042874

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HG975440	1e-152	HG975440.1 Solanum pennellii chromosome ch01, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006344838.1	6e-99	PREDICTED: nuclear transcription factor Y subunit B-5-like
Swissprot	O82248	3e-49	NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBL	M1CB00	1e-97	M1CB00_SOLTU; Uncharacterized protein
STRING	PGSC0003DMT400063671	2e-98	(Solanum tuberosum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA111	24	356

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47810.1	5e-51	nuclear factor Y, subunit B5

Link Out ? help Back to Top
Phytozome	PGSC0003DMP400042874
Entrez Gene	102604033

Publications ? help Back to Top
Xu X, et al. Genome sequence and analysis of the tuber crop potato. Nature, 2011. 475(7355): p. 189-95 [PMID:21743474] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]