PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PGSC0003DMP400043250

Organism

Solanum tuberosum

Taxonomic ID

4113

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

bZIP

Protein Properties

Length: 149aa MW: 17532.9 Da PI: 10.0965

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PGSC0003DMP400043250	genome	PGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	27.2	8.4e-09	16	55	17	56
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 A+rsR RK+++i+eLe+ v++L+ae ++ ele l+++ PGSC0003DMP400043250 16 AQRSRVRKLQYIAELERNVQALQAEGSEVSAELEFLNQQN 55 99*******************************9999876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	0.0038	7	64	IPR004827	Basic-leucine zipper domain
CDD	cd14703	3.30E-12	7	55	No hit	No description
SuperFamily	SSF57959	8.84E-7	13	58	No hit	No description
Gene3D	G3DSA:1.20.5.170	1.1E-6	16	59	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 149 aa Download sequence Send to blast
MKFINIKGVI IYRQFAQRSR VRKLQYIAEL ERNVQALQAE GSEVSAELEF LNQQNLILSM 60 ENKALKQRLE NLAQEQLIKY LEHEVLERER GRLRALYQQL HQQPQPQQHK PSYSHRRSTS 120 RDLDQQFANL TLKQKEAERD AVSGQLHI*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator involved in the sporophytic control of cell wall patterning and gametophytic control of pollen development. May play a role in the control of metabolic pathways regulating cellular transport and lipid metabolism. {ECO:0000269\|PubMed:17719007, ECO:0000269\|PubMed:19449183}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PGSC0003DMP400043250

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT013319	0.0	BT013319.1 Lycopersicon esculentum clone 135006R, mRNA sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015165035.1	4e-89	PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At4g06598-like
Swissprot	F4IN23	8e-23	BZP34_ARATH; Basic leucine zipper 34
TrEMBL	M1CBU6	1e-100	M1CBU6_SOLTU; Uncharacterized protein
STRING	PGSC0003DMT400064169	1e-88	(Solanum tuberosum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G58110.2	3e-53	bZIP family protein

Link Out ? help Back to Top
Phytozome	PGSC0003DMP400043250

Publications ? help Back to Top
Xu X, et al. Genome sequence and analysis of the tuber crop potato. Nature, 2011. 475(7355): p. 189-95 [PMID:21743474] Jiang J,Zhang Z,Cao J Pollen wall development: the associated enzymes and metabolic pathways. Plant Biol (Stuttg), 2013. 15(2): p. 249-63 [PMID:23252839] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Gibalová A, et al. Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte. Plant Reprod, 2017. 30(1): p. 1-17 [PMID:27896439] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470]