![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PGSC0003DMP400044272 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 144aa MW: 16686.2 Da PI: 10.6255 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 99.2 | 1.6e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++nrqvtf+kRrng+lKKA+ELSvLCdae+a+i+fs++g+lyeys+
PGSC0003DMP400044272 9 KRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRLYEYSN 59
79***********************************************95 PP
| |||||||
| 2 | K-box | 73.9 | 4.5e-25 | 79 | 142 | 6 | 69 |
K-box 6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69
++e +a+ +qqe++kL+++i+ +q+++Rhl+Ge+L sL+++eL+qLe++Le+++++iRskK
PGSC0003DMP400044272 79 AYTTQELNAQFYQQESKKLRQQIQLMQNTNRHLVGEGLCSLNVRELKQLENRLERGITRIRSKK 142
33488999*******************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 33.852 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 3.6E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.60E-42 | 2 | 78 | No hit | No description |
| SuperFamily | SSF55455 | 1.96E-33 | 2 | 80 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.9E-33 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.6E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.9E-33 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.9E-33 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 2.3E-18 | 83 | 142 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 11.521 | 87 | 143 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 144 aa Download sequence Send to blast |
MGRGKIEIKR IENNTNRQVT FCKRRNGLLK KAYELSVLCD AEIALIVFST RGRLYEYSNN 60 NVKATIERYK KATAETSSAY TTQELNAQFY QQESKKLRQQ IQLMQNTNRH LVGEGLCSLN 120 VRELKQLENR LERGITRIRS KKV* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 5e-22 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 5e-22 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 5e-22 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 5e-22 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 5e-22 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 5e-22 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 5e-22 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 5e-22 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 5e-22 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 5e-22 | 1 | 69 | 1 | 69 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in seed development. {ECO:0000269|PubMed:29853599}. | |||||
| UniProt | Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269|PubMed:21447172, ECO:0000269|PubMed:29853599, ECO:0000269|Ref.1}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PGSC0003DMP400044272 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY098736 | 0.0 | AY098736.2 Lycopersicon esculentum TAGL11 transcription factor mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006339358.1 | 3e-98 | PREDICTED: agamous-like MADS-box protein AGL11 | ||||
| Swissprot | A0A217EJJ0 | 9e-82 | AG11S_VITVI; Agamous-like MADS-box protein AGL11 | ||||
| Swissprot | F6I457 | 1e-81 | AG11C_VITVI; Agamous-like MADS-box protein AGL11 | ||||
| TrEMBL | A0A0V0HHT9 | 5e-97 | A0A0V0HHT9_SOLCH; Putative agamous-like MADS-box protein AGL11-like | ||||
| TrEMBL | M1CEC0 | 1e-97 | M1CEC0_SOLTU; Uncharacterized protein | ||||
| STRING | PGSC0003DMT400065614 | 1e-97 | (Solanum tuberosum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G09960.2 | 5e-80 | MIKC_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | PGSC0003DMP400044272 |




