PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PGSC0003DMP400044274

Common Name

LOC102605234

Organism

Solanum tuberosum

Taxonomic ID

4113

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

MIKC_MADS

Protein Properties

Length: 233aa MW: 27065.8 Da PI: 9.6268

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PGSC0003DMP400044274	genome	PGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	98	4e-31	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien++nrqvtf+kRrng+lKKA+ELSvLCdae+a+i+fs++g+lyeys+ PGSC0003DMP400044274 9 KRIENNTNRQVTFCKRRNGLLKKAYELSVLCDAEIALIVFSTRGRLYEYSN 59 79***********************************************95 PP
2	K-box	96.8	3.3e-32	79	173	6	100
K-box 6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaL 94 ++e +a+ +qqe++kL+++i+ +q+++Rhl+Ge+L sL+++eL+qLe++Le+++++iRskK+e +l+++e+l k+e +l++en L PGSC0003DMP400044274 79 AYTTQELNAQFYQQESKKLRQQIQLMQNTNRHLVGEGLCSLNVRELKQLENRLERGITRIRSKKHEAILAETENLHKREIQLEQENAFL 167 33478999******************************************************************************* PP K-box 95 rkklee 100 r+k++e PGSC0003DMP400044274 168 RSKIAE 173 *986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	33.852	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	3.6E-41	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.07E-43	2	78	No hit	No description
SuperFamily	SSF55455	5.62E-33	2	79	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.4E-32	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.9E-26	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.4E-32	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.4E-32	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	2.4E-25	83	171	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	15.408	87	177	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 233 aa Download sequence Send to blast
MGRGKIEIKR IENNTNRQVT FCKRRNGLLK KAYELSVLCD AEIALIVFST RGRLYEYSNN 60 NVKATIERYK KATAETSSAY TTQELNAQFY QQESKKLRQQ IQLMQNTNRH LVGEGLCSLN 120 VRELKQLENR LERGITRIRS KKHEAILAET ENLHKREIQL EQENAFLRSK IAENERLQEL 180 SMMPSGEQGG EEYNAFQQYL ARNMLQLNMM ETAVPSYDPL SPDHKRSHLQ LQ*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_Q	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_R	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
1tqe_S	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_A	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_B	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_C	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_D	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_E	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
6c9l_F	4e-21	1	69	1	69	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in seed development (PubMed:21447172, Ref.1, PubMed:29853599). Plays a role in seed morphogenesis by promoting the correct development of endotesta cell layer, which directs the further development of the seed coat, the endosperm, and consequently the embryo (Ref.1, PubMed:29853599). {ECO:0000269\|PubMed:21447172, ECO:0000269\|PubMed:29853599, ECO:0000269\|Ref.1}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PGSC0003DMP400044274

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY098736	0.0	AY098736.2 Lycopersicon esculentum TAGL11 transcription factor mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006339358.1	1e-170	PREDICTED: agamous-like MADS-box protein AGL11
Swissprot	F6I457	1e-108	AG11C_VITVI; Agamous-like MADS-box protein AGL11
TrEMBL	M1CEC2	1e-169	M1CEC2_SOLTU; Uncharacterized protein
STRING	PGSC0003DMT400065614	1e-170	(Solanum tuberosum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA40	24	625

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G09960.1	4e-97	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	PGSC0003DMP400044274
Entrez Gene	102605234

Publications ? help Back to Top
Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ Genome-wide analysis of MIKCC-type MADS box genes in grapevine. Plant Physiol., 2009. 149(1): p. 354-69 [PMID:18997115] Mejía N, et al. Molecular, genetic and transcriptional evidence for a role of VvAGL11 in stenospermocarpic seedlessness in grapevine. BMC Plant Biol., 2011. 11: p. 57 [PMID:21447172] Xu X, et al. Genome sequence and analysis of the tuber crop potato. Nature, 2011. 475(7355): p. 189-95 [PMID:21743474] Grimplet J,Martínez-Zapater JM,Carmona MJ Structural and functional annotation of the MADS-box transcription factor family in grapevine. BMC Genomics, 2016. 17: p. 80 [PMID:26818751] Malabarba J, et al. The MADS-box gene Agamous-like 11 is essential for seed morphogenesis in grapevine. J. Exp. Bot., 2017. 68(7): p. 1493-1506 [PMID:28369525] Royo C, et al. The Major Origin of Seedless Grapes Is Associated with a Missense Mutation in the MADS-Box Gene VviAGL11. Plant Physiol., 2018. 177(3): p. 1234-1253 [PMID:29853599]