![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PGSC0003DMP400045468 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 95aa MW: 10594.2 Da PI: 8.4771 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 61.1 | 1.3e-19 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+ie+ + rq +skR+ +ilKK +EL vLCd++v +++fs+ g++ yss
PGSC0003DMP400045468 9 KKIEDPTSRQQFYSKRKDTILKKSNELAVLCDVDVGLLMFSPAGEVTSYSS 59
68***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 22.427 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 2.3E-24 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 9.16E-23 | 2 | 69 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.4E-16 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 3.2E-20 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.4E-16 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.4E-16 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 95 aa Download sequence Send to blast |
MGRTKLVMKK IEDPTSRQQF YSKRKDTILK KSNELAVLCD VDVGLLMFSP AGEVTSYSSK 60 ESLEDVMLLA MNKAGELNKR SPENPNEQVL SFTH* |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PGSC0003DMP400045468 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975446 | 8e-81 | HG975446.1 Solanum pennellii chromosome ch07, complete genome. | |||
| GenBank | HG975519 | 8e-81 | HG975519.1 Solanum lycopersicum chromosome ch07, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006360566.1 | 6e-59 | PREDICTED: agamous-like MADS-box protein AGL104 | ||||
| Refseq | XP_006360568.1 | 6e-59 | PREDICTED: agamous-like MADS-box protein AGL104 | ||||
| Refseq | XP_006360569.1 | 6e-59 | PREDICTED: agamous-like MADS-box protein AGL104 | ||||
| Refseq | XP_006360570.1 | 6e-59 | PREDICTED: agamous-like MADS-box protein AGL104 | ||||
| Refseq | XP_015170378.1 | 6e-59 | PREDICTED: agamous-like MADS-box protein AGL104 | ||||
| Refseq | XP_015170379.1 | 6e-59 | PREDICTED: agamous-like MADS-box protein AGL104 | ||||
| Refseq | XP_015170380.1 | 6e-59 | PREDICTED: agamous-like MADS-box protein AGL104 | ||||
| TrEMBL | M1CH65 | 7e-63 | M1CH65_SOLTU; Uncharacterized protein | ||||
| STRING | PGSC0003DMT400067393 | 1e-63 | (Solanum tuberosum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA5292 | 18 | 36 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G77980.1 | 6e-20 | AGAMOUS-like 66 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | PGSC0003DMP400045468 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




