![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PGSC0003DMP400047599 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 95aa MW: 10533 Da PI: 3.9512 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 41.2 | 4.8e-13 | 1 | 41 | 61 | 101 |
DUF260 61 lvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101
+vyeA+ar+rdPvyG++g i +lq+q++ l+a+la++++e+
PGSC0003DMP400047599 1 MVYEANARLRDPVYGCAGSICQLQKQVSDLQAQLAKAQAEI 41
69**********************************99875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 9.476 | 1 | 41 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 4.4E-11 | 1 | 38 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 95 aa Download sequence Send to blast |
MVYEANARLR DPVYGCAGSI CQLQKQVSDL QAQLAKAQAE IVNMQCQQAN FMALICMEMG 60 QSTPQTISPP QQSLDNFPMN YLDDNIGSWE TLWT* |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PGSC0003DMP400047599 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC142210 | 1e-151 | AC142210.1 Solanum demissum chromosome 11 clone PGEC589, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006340400.1 | 3e-65 | PREDICTED: LOB domain-containing protein 1 | ||||
| Swissprot | Q9LQR0 | 9e-23 | LBD1_ARATH; LOB domain-containing protein 1 | ||||
| TrEMBL | M1CM43 | 2e-63 | M1CM43_SOLTU; Uncharacterized protein | ||||
| STRING | PGSC0003DMT400070405 | 3e-64 | (Solanum tuberosum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA43 | 24 | 669 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G07900.1 | 1e-23 | LOB domain-containing protein 1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | PGSC0003DMP400047599 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




