PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PGSC0003DMP400047929

Organism

Solanum tuberosum

Taxonomic ID

4113

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

bZIP

Protein Properties

Length: 157aa MW: 17544.8 Da PI: 9.0793

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PGSC0003DMP400047929	genome	PGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	37	7.2e-12	77	108	3	34
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeek 34 ++k++rr+++NReAAr+sR RKka++++Le+ PGSC0003DMP400047929 77 SDKAQRRLAQNREAARKSRMRKKAYVQQLETS 108 79***************************974 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.20.5.170	8.6E-9	74	120	No hit	No description
SMART	SM00338	1.3E-5	75	135	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	7.6E-8	77	109	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	9.013	77	121	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	3.19E-8	79	114	No hit	No description
PROSITE pattern	PS00036	0	82	97	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0042742	Biological Process	defense response to bacterium
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0044212	Molecular Function	transcription regulatory region DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 157 aa Download sequence Send to blast
MTSPTTQFAP TRRMGIYEPF HQMSVWEDAF RGDIMPSADA CMVSHPNDRP DDKSGYTSGE 60 QHMPSGSGDN QAPRSSSDKA QRRLAQNREA ARKSRMRKKA YVQQLETSRL KLAQLELELE 120 RARQQGLYML GSNSNMGLLG TINPGIWIEE LSLVTL*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00586	DAP	Transfer from AT5G65210	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PGSC0003DMP400047929

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT014216	0.0	BT014216.1 Lycopersicon esculentum clone 133394F, mRNA sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006354048.1	1e-105	PREDICTED: transcription factor TGA4-like isoform X1
Refseq	XP_006354049.1	1e-105	PREDICTED: transcription factor TGA1-like isoform X2
Refseq	XP_006354050.1	1e-105	PREDICTED: transcription factor TGA1-like isoform X2
Swissprot	Q39237	2e-39	TGA1_ARATH; Transcription factor TGA1
TrEMBL	M1CMV9	1e-113	M1CMV9_SOLTU; Uncharacterized protein
STRING	PGSC0003DMT400070884	1e-104	(Solanum tuberosum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G65210.5	4e-28	bZIP family protein

Link Out ? help Back to Top
Phytozome	PGSC0003DMP400047929

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Xu X, et al. Genome sequence and analysis of the tuber crop potato. Nature, 2011. 475(7355): p. 189-95 [PMID:21743474] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Herrera-Vásquez A, et al. Transcriptional Control of Glutaredoxin GRXC9 Expression by a Salicylic Acid-Dependent and NPR1-Independent Pathway in Arabidopsis. Plant Mol. Biol. Rep., 2018. [PMID:26696694] Gutsche N,Zachgo S The N-Terminus of the Floral Arabidopsis TGA Transcription Factor PERIANTHIA Mediates Redox-Sensitive DNA-Binding. PLoS ONE, 2016. 11(4): p. e0153810 [PMID:27128442] Sun T, et al. TGACG-BINDING FACTOR 1 (TGA1) and TGA4 regulate salicylic acid and pipecolic acid biosynthesis by modulating the expression of SYSTEMIC ACQUIRED RESISTANCE DEFICIENT 1 (SARD1) and CALMODULIN-BINDING PROTEIN 60g (CBP60g). New Phytol., 2018. 217(1): p. 344-354 [PMID:28898429]