![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PGSC0003DMP400048866 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 66aa MW: 7319.48 Da PI: 5.7039 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 37 | 8e-12 | 14 | 45 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32
+g+WT+eEd +lv +++++G+g+W++++ g
PGSC0003DMP400048866 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTG 45
79*************************98776 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 2.1E-13 | 5 | 43 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 2.87E-10 | 8 | 44 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 11.288 | 9 | 65 | IPR017930 | Myb domain |
| Pfam | PF00249 | 4.9E-10 | 14 | 44 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 5.52E-7 | 16 | 40 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009414 | Biological Process | response to water deprivation | ||||
| GO:0009416 | Biological Process | response to light stimulus | ||||
| GO:0009737 | Biological Process | response to abscisic acid | ||||
| GO:0009751 | Biological Process | response to salicylic acid | ||||
| GO:0009753 | Biological Process | response to jasmonic acid | ||||
| GO:0010118 | Biological Process | stomatal movement | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 66 aa Download sequence Send to blast |
MGRPPCCDKI GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGKLVAI LIIIFSISDD 60 VWYSY* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light). {ECO:0000269|PubMed:22018045}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00132 | DAP | Transfer from AT1G08810 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PGSC0003DMP400048866 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by abscisic acid (ABA) and osmotic stress (salt stress). {ECO:0000269|PubMed:22018045}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975522 | 2e-65 | HG975522.1 Solanum lycopersicum chromosome ch10, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017621802.1 | 4e-29 | PREDICTED: myb-related protein 306-like isoform X1 | ||||
| Swissprot | B3VTV7 | 2e-29 | MYB60_VITVI; Transcription factor MYB60 | ||||
| TrEMBL | M1CPZ9 | 3e-40 | M1CPZ9_SOLTU; Uncharacterized protein | ||||
| STRING | XP_008442096.1 | 3e-28 | (Cucumis melo) | ||||
| STRING | XP_004137409.1 | 3e-28 | (Cucumis sativus) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G62470.2 | 2e-30 | myb domain protein 96 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | PGSC0003DMP400048866 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




