![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PGSC0003DMP400048931 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 155aa MW: 16915.4 Da PI: 9.6578 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 107.2 | 9.1e-34 | 28 | 82 | 1 | 55 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
kprl+Wtp+LHerF+eav+qLGG++kAtPk++l+lm+++gLtl+h+kSHLQkYRl
PGSC0003DMP400048931 28 KPRLKWTPDLHERFIEAVTQLGGADKATPKSVLKLMGIPGLTLYHLKSHLQKYRL 82
79****************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 12.132 | 25 | 85 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 3.9E-32 | 26 | 84 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.76E-17 | 27 | 85 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 2.4E-24 | 28 | 83 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 2.0E-10 | 30 | 81 | IPR001005 | SANT/Myb domain |
| Pfam | PF14379 | 2.0E-10 | 127 | 149 | IPR025756 | MYB-CC type transcription factor, LHEQLE-containing domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 155 aa Download sequence Send to blast |
MSFPERHLFL QGGNANGDSG LVLSTDAKPR LKWTPDLHER FIEAVTQLGG ADKATPKSVL 60 KLMGIPGLTL YHLKSHLQKY RLSKNHHGQA NLSGVNKAAA SMEKICESTG SPTSNPSIGP 120 QPNNNIPISE AIQMQIDVQR RLHEQLEVRN CCKI* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6j4k_A | 2e-23 | 28 | 84 | 2 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4k_B | 2e-23 | 28 | 84 | 2 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_A | 2e-23 | 28 | 84 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_B | 2e-23 | 28 | 84 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_C | 2e-23 | 28 | 84 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j4r_D | 2e-23 | 28 | 84 | 1 | 57 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_A | 2e-23 | 28 | 84 | 2 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_C | 2e-23 | 28 | 84 | 2 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_D | 2e-23 | 28 | 84 | 2 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_F | 2e-23 | 28 | 84 | 2 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_H | 2e-23 | 28 | 84 | 2 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| 6j5b_J | 2e-23 | 28 | 84 | 2 | 58 | Protein PHOSPHATE STARVATION RESPONSE 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:15592750}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PGSC0003DMP400048931 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269|PubMed:15592750}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975449 | 2e-79 | HG975449.1 Solanum pennellii chromosome ch10, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006339132.1 | 1e-104 | PREDICTED: uncharacterized protein LOC102602766 isoform X3 | ||||
| Swissprot | Q9SQQ9 | 6e-66 | PHL9_ARATH; Myb-related protein 2 | ||||
| TrEMBL | M1CQ63 | 1e-111 | M1CQ63_SOLTU; Uncharacterized protein | ||||
| STRING | PGSC0003DMT400072373 | 1e-104 | (Solanum tuberosum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G04030.1 | 1e-68 | G2-like family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | PGSC0003DMP400048931 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




