PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400051753
Common NameLOC102582383
Organism
Solanum tuberosum
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family SBP
Protein Properties Length: 99aa    MW: 11228.5 Da    PI: 7.0163
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400051753genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP75.58.9e-245298248
                          -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
                   SBP  2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48
                          Cqv++C+a++++ak yhrrhkvCe+hsk+p vl+sgl+qrfCqqCsr
  PGSC0003DMP400051753 52 CQVDQCTANMADAKPYHRRHKVCEFHSKSPIVLISGLQQRFCQQCSR 98
                          **********************************************8 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.1E-244598IPR004333Transcription factor, SBP-box
PROSITE profilePS5114119.9484998IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.97E-225098IPR004333Transcription factor, SBP-box
PfamPF031103.9E-185298IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 99 aa     Download sequence    Send to blast
METNKWEGKR SINEAEEEED EHESVEEDSK RKRVLTLSGR KLAGEGSAHP SCQVDQCTAN  60
MADAKPYHRR HKVCEFHSKS PIVLISGLQQ RFCQQCSR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-2052981157squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPGSC0003DMP400051753
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHM1558621e-149HM155862.1 Solanum chilense isolate 2_P3CNRDseq genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006347009.16e-68PREDICTED: squamosa promoter-binding protein 1 isoform X1
SwissprotQ387416e-35SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBLM1CWP02e-66M1CWP0_SOLTU; Squamosa promoter-binding-like protein
TrEMBLM1CWP17e-67M1CWP1_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000763994e-67(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.11e-23squamosa promoter binding protein-like 3
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]
  2. Klein J,Saedler H,Huijser P
    A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA.
    Mol. Gen. Genet., 1996. 250(1): p. 7-16
    [PMID:8569690]