![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PGSC0003DMP400051753 | ||||||||
| Common Name | LOC102582383 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 99aa MW: 11228.5 Da PI: 7.0163 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 75.5 | 8.9e-24 | 52 | 98 | 2 | 48 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48
Cqv++C+a++++ak yhrrhkvCe+hsk+p vl+sgl+qrfCqqCsr
PGSC0003DMP400051753 52 CQVDQCTANMADAKPYHRRHKVCEFHSKSPIVLISGLQQRFCQQCSR 98
**********************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.1100.10 | 2.1E-24 | 45 | 98 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 19.948 | 49 | 98 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 4.97E-22 | 50 | 98 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 3.9E-18 | 52 | 98 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009911 | Biological Process | positive regulation of flower development | ||||
| GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
| GO:0010229 | Biological Process | inflorescence development | ||||
| GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046872 | Molecular Function | metal ion binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 99 aa Download sequence Send to blast |
METNKWEGKR SINEAEEEED EHESVEEDSK RKRVLTLSGR KLAGEGSAHP SCQVDQCTAN 60 MADAKPYHRR HKVCEFHSKS PIVLISGLQQ RFCQQCSR* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 8e-20 | 52 | 98 | 11 | 57 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00290 | DAP | Transfer from AT2G33810 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PGSC0003DMP400051753 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HM155862 | 1e-149 | HM155862.1 Solanum chilense isolate 2_P3CNRDseq genomic sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006347009.1 | 6e-68 | PREDICTED: squamosa promoter-binding protein 1 isoform X1 | ||||
| Swissprot | Q38741 | 6e-35 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
| TrEMBL | M1CWP0 | 2e-66 | M1CWP0_SOLTU; Squamosa promoter-binding-like protein | ||||
| TrEMBL | M1CWP1 | 7e-67 | M1CWP1_SOLTU; Uncharacterized protein | ||||
| STRING | PGSC0003DMT400076399 | 4e-67 | (Solanum tuberosum) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G33810.1 | 1e-23 | squamosa promoter binding protein-like 3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | PGSC0003DMP400051753 |
| Entrez Gene | 102582383 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




