PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PGSC0003DMP400053169

Organism

Solanum tuberosum

Taxonomic ID

4113

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

MYB

Protein Properties

Length: 149aa MW: 17307.8 Da PI: 9.133

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PGSC0003DMP400053169	genome	PGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	56.1	8.4e-18	3	50	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+W+++Ed++l+d+++++G g+W+ ++ g+ R++k+c++rw +yl PGSC0003DMP400053169 3 KGAWSKQEDQKLIDYITKHGEGCWRDLPKAAGLLRCGKSCRLRWMNYL 50 79****************************99**********97 PP
2	Myb_DNA-binding	45.5	1.8e-14	56	101	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+++++Ed+l+++++++lG++ W++Ia++++ + ++k++w+++l PGSC0003DMP400053169 56 RGNFSEDEDDLIIKLHALLGNR-WSLIAERLP-EHSTIEVKNYWNSHL 101 89******************.*****.9*********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	18.012	1	50	IPR017930	Myb domain
SuperFamily	SSF46689	8.11E-27	2	97	IPR009057	Homeodomain-like
SMART	SM00717	1.0E-12	2	52	IPR001005	SANT/Myb domain
Pfam	PF00249	1.2E-15	3	50	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	3.8E-23	4	57	IPR009057	Homeodomain-like
CDD	cd00167	1.27E-9	5	50	No hit	No description
PROSITE profile	PS51294	24.163	51	105	IPR017930	Myb domain
SMART	SM00717	1.2E-13	55	103	IPR001005	SANT/Myb domain
Pfam	PF00249	1.4E-13	56	101	IPR001005	SANT/Myb domain
CDD	cd00167	5.25E-9	58	101	No hit	No description
Gene3D	G3DSA:1.10.10.60	7.0E-23	58	105	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 149 aa Download sequence Send to blast
MHKGAWSKQE DQKLIDYITK HGEGCWRDLP KAAGLLRCGK SCRLRWMNYL NPNLKRGNFS 60 EDEDDLIIKL HALLGNRWSL IAERLPEHST IEVKNYWNSH LKLKLTKMGI DPMNYRIQEY 120 VHKKNLEFFS SRNKGFDVEI SDAESSSA*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	2e-26	1	105	25	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PGSC0003DMP400053169

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By nitrogen, salicylic acid, NaCl and abscisic acid (ABA). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:18541146, ECO:0000269\|PubMed:9839469}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015075126.1	4e-79	transcription factor MYB3-like
Swissprot	Q9S9K9	6e-60	MYB3_ARATH; Transcription factor MYB3
TrEMBL	M1D068	1e-106	M1D068_SOLTU; Uncharacterized protein
STRING	PGSC0003DMT400078477	2e-78	(Solanum tuberosum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22640.1	3e-62	myb domain protein 3

Link Out ? help Back to Top
Phytozome	PGSC0003DMP400053169

Publications ? help Back to Top
Xu X, et al. Genome sequence and analysis of the tuber crop potato. Nature, 2011. 475(7355): p. 189-95 [PMID:21743474] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Wada T,Hayashi N,Tominaga-Wada R Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis. Plant Signal Behav, 2015. 10(11): p. e1089372 [PMID:26339713] Wada T,Tominaga-Wada R CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression. Plant Sci., 2015. 241: p. 260-5 [PMID:26706076] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275]