![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PGSC0003DMP400053969 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 136aa MW: 15019.8 Da PI: 5.2229 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 106.9 | 1.3e-33 | 1 | 80 | 17 | 96 |
NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96
m+k+lP +akis+ +k ++qecvsefi+f+t+ea+d cqr++r+ti+++d+l a+ +Gf+dyv +l +yl++yre +g
PGSC0003DMP400053969 1 MHKILPPHAKISDGSKLITQECVSEFIGFITGEANDCCQRDQRNTITAEDVLCAMDRFGFDDYVGTLALYLHRYREYDGG 80
89**************************************************************************9875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 4.7E-30 | 1 | 86 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.9E-12 | 1 | 55 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| SuperFamily | SSF47113 | 4.02E-24 | 1 | 84 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 7.9E-9 | 19 | 37 | No hit | No description |
| PRINTS | PR00615 | 7.9E-9 | 38 | 56 | No hit | No description |
| PRINTS | PR00615 | 7.9E-9 | 57 | 75 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 136 aa Download sequence Send to blast |
MHKILPPHAK ISDGSKLITQ ECVSEFIGFI TGEANDCCQR DQRNTITAED VLCAMDRFGF 60 DDYVGTLALY LHRYREYDGG RGSTRREPLL LRRSMVNPAS VYSITPYQGD ASNGNTSQGD 120 AVDIKVESPV KEAKE* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 3e-35 | 1 | 76 | 22 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PGSC0003DMP400053969 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975444 | 1e-155 | HG975444.1 Solanum pennellii chromosome ch05, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006365238.1 | 2e-98 | PREDICTED: nuclear transcription factor Y subunit B-6-like | ||||
| Swissprot | Q84W66 | 2e-35 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
| TrEMBL | M1D230 | 4e-97 | M1D230_SOLTU; Uncharacterized protein | ||||
| STRING | PGSC0003DMT400079574 | 7e-98 | (Solanum tuberosum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA111 | 24 | 356 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G47670.2 | 3e-38 | nuclear factor Y, subunit B6 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | PGSC0003DMP400053969 |




