PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PGSC0003DMP400055611

Organism

Solanum tuberosum

Taxonomic ID

4113

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

NF-YB

Protein Properties

Length: 133aa MW: 14570.7 Da PI: 7.1866

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PGSC0003DMP400055611	genome	PGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	174.2	1.4e-54	27	120	1	94
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkk 89 vreqdr+lPian++rimkk lPanaki+k+ak+tvqecvsefisf+tseasdkcq+ekrktingddl+w+l+tlGfedy+eplk+yl + PGSC0003DMP400055611 27 VREQDRYLPIANIGRIMKKGLPANAKIAKEAKDTVQECVSEFISFITSEASDKCQKEKRKTINGDDLVWSLTTLGFEDYIEPLKAYLIR 115 69************************************************************************************* PP NF-YB 90 yrele 94 yre+ PGSC0003DMP400055611 116 YREVI 120 *85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	5.0E-50	23	119	IPR009072	Histone-fold
SuperFamily	SSF47113	1.71E-37	30	120	IPR009072	Histone-fold
Pfam	PF00808	1.1E-26	33	96	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	1.0E-19	61	79	No hit	No description
PROSITE pattern	PS00685	0	64	80	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	1.0E-19	80	98	No hit	No description
PRINTS	PR00615	1.0E-19	99	117	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 133 aa Download sequence Send to blast
MAEVPASPGG GCGSHESGGE RSPQSNVREQ DRYLPIANIG RIMKKGLPAN AKIAKEAKDT 60 VQECVSEFIS FITSEASDKC QKEKRKTING DDLVWSLTTL GFEDYIEPLK AYLIRYREVI 120 AVPPQLLMIS KL*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	6e-46	27	118	1	92	Transcription factor HapC (Eurofung)
4g92_B	6e-46	27	118	1	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PGSC0003DMP400055611

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HG975443	1e-105	HG975443.1 Solanum pennellii chromosome ch04, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006359336.1	5e-84	PREDICTED: nuclear transcription factor Y subunit B-1-like
Refseq	XP_015074252.1	5e-84	nuclear transcription factor Y subunit B-10-like
Refseq	XP_015169862.1	5e-84	PREDICTED: nuclear transcription factor Y subunit B-1-like
Refseq	XP_027772469.1	5e-84	nuclear transcription factor Y subunit B-10-like
Swissprot	Q8VYK4	2e-66	NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBL	M1D601	4e-93	M1D601_SOLTU; Uncharacterized protein
STRING	PGSC0003DMT400082465	7e-94	(Solanum tuberosum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA111	24	356

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G37060.3	5e-58	nuclear factor Y, subunit B8

Link Out ? help Back to Top
Phytozome	PGSC0003DMP400055611

Publications ? help Back to Top
Xu X, et al. Genome sequence and analysis of the tuber crop potato. Nature, 2011. 475(7355): p. 189-95 [PMID:21743474] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]