![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PGSC0003DMP400056744 | ||||||||
| Common Name | LOC107058472 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 112aa MW: 12638.3 Da PI: 10.9169 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 43.6 | 6.7e-14 | 45 | 90 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+rWT++E+ ++++ + +G+g+W+ Ia+ + Rt q+ s+ qky
PGSC0003DMP400056744 45 NRWTEDEQRAFLKGLNFHGKGNWTNIAKDFVPSRTSTQVASHAQKY 90
69*****************************9*************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 16.82 | 39 | 95 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 7.1E-12 | 41 | 91 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 8.61E-16 | 42 | 94 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 1.1E-14 | 42 | 93 | IPR006447 | Myb domain, plants |
| SMART | SM00717 | 1.9E-11 | 43 | 93 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.1E-11 | 45 | 90 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 7.82E-10 | 46 | 91 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 112 aa Download sequence Send to blast |
MDRNCSENGK SIKLFGFEIT TTTTSSAAAL TSEKDFMGRK IKKGNRWTED EQRAFLKGLN 60 FHGKGNWTNI AKDFVPSRTS TQVASHAQKY FLRLLDANSN ERKKRKKSSV F* |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 102 | 106 | KKRKK |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PGSC0003DMP400056744 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC247135 | 2e-88 | AC247135.8 Solanum lycopersicum strain Heinz 1706 chromosome 11 clone slm-6o7 map 11, complete sequence. | |||
| GenBank | AC254057 | 2e-88 | AC254057.5 Solanum lycopersicum strain Heinz 1706 chromosome 11 clone sle-28f9 map 11, complete sequence. | |||
| GenBank | HG975523 | 2e-88 | HG975523.1 Solanum lycopersicum chromosome ch11, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015159699.1 | 3e-77 | PREDICTED: transcription factor MYB1R1-like | ||||
| Swissprot | Q9FKF9 | 3e-20 | M5162_ARATH; Probable transcription factor At5g61620 | ||||
| TrEMBL | M1D8P1 | 6e-76 | M1D8P1_SOLTU; Uncharacterized protein | ||||
| STRING | PGSC0003DMT400085069 | 1e-76 | (Solanum tuberosum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA7454 | 12 | 30 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G01200.1 | 4e-20 | MYB family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | PGSC0003DMP400056744 |
| Entrez Gene | 107058472 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




