![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PGSC0003DMP400056849 | ||||||||
| Common Name | LOC102594116 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 134aa MW: 15111.3 Da PI: 9.4476 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 131.7 | 2.5e-41 | 20 | 94 | 2 | 76 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76
Cqve+Ce++l +ak+yh+rhkvC+vh+kap vl++gl+qrfCqqCsrfhelsefD +k+sCr rL++hn+rrrk+
PGSC0003DMP400056849 20 CQVEKCEVNLDDAKKYHKRHKVCQVHAKAPIVLLAGLRQRFCQQCSRFHELSEFDGTKKSCRLRLDGHNKRRRKT 94
*************************************************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.1100.10 | 2.3E-31 | 17 | 81 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 30.342 | 17 | 94 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 3.66E-37 | 18 | 96 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 1.7E-32 | 20 | 93 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 134 aa Download sequence Send to blast |
MANNDGGGGV GVVVQVKHYC QVEKCEVNLD DAKKYHKRHK VCQVHAKAPI VLLAGLRQRF 60 CQQCSRFHEL SEFDGTKKSC RLRLDGHNKR RRKTPLAIEM EDNQCRLING EASPHMDMTL 120 SSRNTIHTAD ISR* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 7e-32 | 20 | 93 | 11 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PGSC0003DMP400056849 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975519 | 5e-86 | HG975519.1 Solanum lycopersicum chromosome ch07, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006348264.1 | 3e-96 | PREDICTED: squamosa promoter-binding-like protein 3 | ||||
| Swissprot | Q38741 | 1e-34 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
| Swissprot | Q6Z461 | 5e-34 | SPL13_ORYSJ; Squamosa promoter-binding-like protein 13 | ||||
| TrEMBL | M1D8X0 | 7e-95 | M1D8X0_SOLTU; Uncharacterized protein | ||||
| STRING | PGSC0003DMT400085174 | 1e-95 | (Solanum tuberosum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA749 | 24 | 105 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G33810.1 | 1e-35 | squamosa promoter binding protein-like 3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | PGSC0003DMP400056849 |
| Entrez Gene | 102594116 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




