PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PGSC0003DMP400058110

Organism

Solanum tuberosum

Taxonomic ID

4113

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

M-type_MADS

Protein Properties

Length: 106aa MW: 11831.2 Da PI: 11.3819

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PGSC0003DMP400058110	genome	PGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	69.4	3.3e-22	17	60	3	46
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46 i+ sn vtfskRr+g++KKA+EL++LC+ae+ ++ifs++gk+ PGSC0003DMP400058110 17 IKKASNLGVTFSKRRAGLFKKASELCTLCGAEIVIVIFSPDGKM 60 8899999***********************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.3E-23	7	66	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	20.451	7	60	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	2.88E-20	8	62	IPR002100	Transcription factor, MADS-box
CDD	cd00120	3.43E-22	8	59	No hit	No description
PRINTS	PR00404	2.0E-14	9	29	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	8.7E-23	16	61	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.0E-14	29	44	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.0E-14	44	65	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 106 aa Download sequence Send to blast
MTRKISKGRQ RVDMVKIKKA SNLGVTFSKR RAGLFKKASE LCTLCGAEIV IVIFSPDGKM 60 CSPLVTLAWK RWWRGSGFLH QITMSTINKS WLVEKLVFVN SIPSS*

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Required for suppression of cellularization and promotion of nuclear proliferation during early endosperm development. The FERTILIZATION-INDEPENDENT SEED (FIS) polycomb complex is required for suppression of ALG62 expression at the end of the syncytial phase of endosperm development. {ECO:0000269\|PubMed:18334668}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PGSC0003DMP400058110

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	HG975443	3e-77	HG975443.1 Solanum pennellii chromosome ch04, complete genome.
GenBank	HG975516	3e-77	HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006357733.1	5e-31	PREDICTED: agamous-like MADS-box protein AGL62
Swissprot	Q9FKK2	5e-23	AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBL	M1DBR2	6e-70	M1DBR2_SOLTU; Uncharacterized protein
STRING	PGSC0003DMT400086435	1e-70	(Solanum tuberosum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA204	24	223

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60440.1	2e-25	AGAMOUS-like 62

Link Out ? help Back to Top
Phytozome	PGSC0003DMP400058110

Publications ? help Back to Top
Xu X, et al. Genome sequence and analysis of the tuber crop potato. Nature, 2011. 475(7355): p. 189-95 [PMID:21743474] Xu W, et al. Endosperm and Nucellus Develop Antagonistically in Arabidopsis Seeds. Plant Cell, 2016. 28(6): p. 1343-60 [PMID:27233529] Figueiredo DD,Batista RA,Roszak PJ,Köhler C Auxin production couples endosperm development to fertilization. Nat Plants, 2015. 1: p. 15184 [PMID:27251719] Figueiredo DD,Batista RA,Roszak PJ,Hennig L,Köhler C Auxin production in the endosperm drives seed coat development in Arabidopsis. Elife, 2017. [PMID:27848912] Fiume E,Coen O,Xu W,Lepiniec L,Magnani E Growth of the Arabidopsis sub-epidermal integument cell layers might require an endosperm signal. Plant Signal Behav, 2017. 12(8): p. e1339000 [PMID:28613109] Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]