![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PGSC0003DMP400058518 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 83aa MW: 9609.41 Da PI: 10.5289 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 64.3 | 1.3e-20 | 8 | 58 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+ie+ ++rqvtfskRr +lKKA+E+ + Cd++v+++ fs+ ++l ++s
PGSC0003DMP400058518 8 KKIEDIIKRQVTFSKRRSSLLKKAKEIAISCDVDVLLVAFSPANRLSKFCS 58
68**********************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 2.3E-22 | 1 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 22.315 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 9.4E-18 | 2 | 22 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.23E-24 | 3 | 76 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 8.7E-20 | 9 | 56 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 9.4E-18 | 22 | 37 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 9.4E-18 | 37 | 58 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 83 aa Download sequence Send to blast |
MGRKIEIKKI EDIIKRQVTF SKRRSSLLKK AKEIAISCDV DVLLVAFSPA NRLSKFCSQN 60 RIEDILQRYI ELPIERKLTY VN* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PGSC0003DMP400058518 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | HG975443 | 4e-73 | HG975443.1 Solanum pennellii chromosome ch04, complete genome. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006363956.1 | 1e-50 | PREDICTED: agamous-like MADS-box protein AGL104 | ||||
| Swissprot | Q9LM46 | 1e-22 | AG104_ARATH; Agamous-like MADS-box protein AGL104 | ||||
| TrEMBL | M1DCL7 | 8e-51 | M1DCL7_SOLTU; Uncharacterized protein | ||||
| STRING | PGSC0003DMT400086843 | 1e-51 | (Solanum tuberosum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA3785 | 12 | 19 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G22130.1 | 8e-14 | AGAMOUS-like 104 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | PGSC0003DMP400058518 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




