![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PGSC0003DMP400061939 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 153aa MW: 17130.5 Da PI: 9.8313 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 69.1 | 4.2e-22 | 15 | 61 | 3 | 49 |
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
n+sn qvtfskRr g++KKA ELS+LC+a+v +++fs+++k y y
PGSC0003DMP400061939 15 MPNQSNLQVTFSKRRDGVFKKATELSTLCGADVVIVVFSPSNKPYSY 61
569***************************************99888 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.8E-29 | 5 | 64 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 24.165 | 5 | 65 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 3.75E-32 | 6 | 77 | No hit | No description |
| SuperFamily | SSF55455 | 1.83E-26 | 6 | 79 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.5E-19 | 7 | 27 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.4E-23 | 16 | 61 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.5E-19 | 27 | 42 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.5E-19 | 42 | 63 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 153 aa Download sequence Send to blast |
MRRPNGRRRV EMTRMPNQSN LQVTFSKRRD GVFKKATELS TLCGADVVIV VFSPSNKPYS 60 YGHPSVESIM NRFLGGNPPT DTDAPNPIVI AHQNANTDEI NRKLNRLEIS LEREKKYGEA 120 LQASRKEPPI EKLSSFDLKN MCKALEAADE VN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3kov_A | 2e-17 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3kov_B | 2e-17 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3kov_I | 2e-17 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3kov_J | 2e-17 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3p57_A | 2e-17 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3p57_B | 2e-17 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3p57_C | 2e-17 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3p57_D | 2e-17 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3p57_I | 2e-17 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| 3p57_J | 2e-17 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PGSC0003DMP400061939 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC243026 | 0.0 | AC243026.1 Solanum tuberosum chromosome 11 clone RH059C07, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006362321.1 | 1e-101 | PREDICTED: agamous-like MADS-box protein AGL62 | ||||
| TrEMBL | M1DK05 | 1e-109 | M1DK05_SOLTU; Uncharacterized protein | ||||
| STRING | PGSC0003DMT400090264 | 1e-109 | (Solanum tuberosum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Asterids | OGEA204 | 24 | 223 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G60440.1 | 8e-35 | AGAMOUS-like 62 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | PGSC0003DMP400061939 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




