PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PH01000008G1430

Organism

Phyllostachys heterocycla

Taxonomic ID

38705

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys

Family

MYB_related

Protein Properties

Length: 157aa MW: 18520.6 Da PI: 12.3454

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PH01000008G1430	genome	ICBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	54.1	3.5e-17	36	78	2	46
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +++ eE+e+l a++ +G++ W+ Iar ++ gRt++ +k++w+ PH01000008G1430 36 RPFSDEEEERLMAAHRFYGNK-WAMIARLFP-GRTDNAVKNHWHV 78 68*****************.*****.*********96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	7.6E-9	18	42	IPR009057	Homeodomain-like
SuperFamily	SSF46689	2.14E-22	18	88	IPR009057	Homeodomain-like
PROSITE profile	PS51294	24.91	30	84	IPR017930	Myb domain
SMART	SM00717	4.9E-13	34	82	IPR001005	SANT/Myb domain
Pfam	PF00249	2.1E-13	35	77	IPR001005	SANT/Myb domain
CDD	cd00167	1.00E-9	37	77	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.6E-17	43	78	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 157 aa Download sequence Send to blast
MDEDDTVAVR TNVSISAGKS CRLRWFNQLD PRISKRPFSD EEEERLMAAH RFYGNKWAMI 60 ARLFPGRTDN AVKNHWHVIM ARKYREQSTA YRRRKLNQAV QRVGRRGRRR PPPPRGRGPR 120 RRCLRRPLRL QLPALLLPFP RRCRLSRGAS LLLVPW*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	5e-21	18	83	42	107	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that involved in boundary specification, meristem initiation and maintenance, and organ patterning. Functions in both lateral organ separation and axillary meristem formation. {ECO:0000269\|PubMed:19542355}.
UniProt	Probable transcription factor that involved in boundary specification, meristem initiation and maintenance, and organ patterning (PubMed:19542355, PubMed:21533201). Functions in both lateral organ separation and axillary meristem formation, in part through genetic interaction with the NAC domain genes CUC2 and CUC3 and the homeobox gene STM (PubMed:19542355). May be recruited by a variety of developmental programs for the development of floral organs and the initiation of ovule outgrowth (PubMed:21533201). {ECO:0000269\|PubMed:19542355, ECO:0000269\|PubMed:21533201}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PH01000008G1430

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	CP012616	1e-111	CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015695613.1	3e-56	PREDICTED: transcription factor MYB23-like
Refseq	XP_021320356.1	2e-55	transcription factor MYB80
Refseq	XP_025883218.1	1e-55	transcription factor CSA-like isoform X1
Refseq	XP_025883219.1	1e-55	transcription factor CSA-like isoform X2
Swissprot	Q9LQX5	4e-44	MY117_ARATH; Transcription factor MYB117
Swissprot	Q9SEZ4	3e-44	MY105_ARATH; Transcription factor MYB105
TrEMBL	A0A0E0ELX0	4e-55	A0A0E0ELX0_9ORYZ; Uncharacterized protein
TrEMBL	A0A0E0LV69	5e-55	A0A0E0LV69_ORYPU; Uncharacterized protein
TrEMBL	A0A0P0XGE9	5e-55	A0A0P0XGE9_ORYSJ; Os08g0435700 protein
TrEMBL	A0A1D6KP29	2e-55	A0A1D6KP29_MAIZE; Myb domain protein 105
STRING	OS08T0435700-00	9e-56	(Oryza sativa)
STRING	OPUNC08G13850.2	8e-56	(Oryza punctata)
STRING	Traes_3AL_825A1B8BD.1	6e-56	(Triticum aestivum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP294	38	260

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G26780.1	4e-48	myb domain protein 117

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Colling J, et al. Hypersensitivity of Arabidopsis TAXIMIN1 overexpression lines to light stress is correlated with decreased sinapoyl malate abundance and countered by the antibiotic cefotaxime. Plant Signal Behav, 2016. 11(4): p. e1143998 [PMID:26967827]