![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PH01000058G1000 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
|
||||||||
| Family | SRS | ||||||||
| Protein Properties | Length: 134aa MW: 13798.1 Da PI: 4.7557 | ||||||||
| Description | SRS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF702 | 84 | 3.6e-26 | 12 | 63 | 103 | 154 |
DUF702 103 sslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
+slP++v+++avf+cvrv+s+ddge+e+aYq+ v+i+GhvfkG+LydqG+++
PH01000058G1000 12 ESLPRHVRAPAVFKCVRVTSIDDGEDEYAYQAMVTINGHVFKGFLYDQGIDD 63
67***********************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF05142 | 1.2E-23 | 11 | 62 | IPR007818 | Protein of unknown function DUF702 |
| TIGRFAMs | TIGR01624 | 2.2E-28 | 14 | 61 | IPR006511 | Lateral Root Primordium type 1, C-terminal |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 134 aa Download sequence Send to blast |
MATYYVYASF RESLPRHVRA PAVFKCVRVT SIDDGEDEYA YQAMVTINGH VFKGFLYDQG 60 IDDGRLAATS NDDSTAGVPN ISELHLGGAS VSGPGGNAVR EGGSSMLPSD LYGGSGGGGP 120 HVLGGSSYGN TMN* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds DNA on 5'-ACTCTAC-3' and promotes auxin homeostasis-regulating gene expression (e.g. YUC genes), as well as genes affecting stamen development, cell expansion and timing of flowering. Synergistically with other SHI-related proteins, regulates gynoecium, stamen and leaf development in a dose-dependent manner, controlling apical-basal patterning. Promotes style and stigma formation, and influence vascular development during gynoecium development. May also have a role in the formation and/or maintenance of the shoot apical meristem (SAM). Modulates root growth. {ECO:0000269|PubMed:16740146, ECO:0000269|PubMed:18835563}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PH01000058G1000 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Expression repressed by LDL1 via histone H3 and H4 deacetylation. {ECO:0000269|PubMed:18835563}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CP012609 | 1e-100 | CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015691020.1 | 2e-66 | PREDICTED: protein LATERAL ROOT PRIMORDIUM 1, partial | ||||
| Swissprot | Q94CK9 | 4e-24 | LRP1_ARATH; Protein LATERAL ROOT PRIMORDIUM 1 | ||||
| TrEMBL | A0A0D3EYS8 | 8e-63 | A0A0D3EYS8_9ORYZ; Uncharacterized protein | ||||
| TrEMBL | A0A0E0N7R3 | 7e-63 | A0A0E0N7R3_ORYRU; Uncharacterized protein | ||||
| TrEMBL | I1NVC0 | 8e-63 | I1NVC0_ORYGL; Uncharacterized protein | ||||
| STRING | ORUFI01G47660.1 | 1e-63 | (Oryza rufipogon) | ||||
| STRING | ORGLA01G0381000.1 | 1e-63 | (Oryza glaberrima) | ||||
| STRING | OBART01G44230.1 | 1e-63 | (Oryza barthii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP3579 | 36 | 79 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G12330.2 | 9e-27 | Lateral root primordium (LRP) protein-related | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




