PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PH01001056G0170

Organism

Phyllostachys heterocycla

Taxonomic ID

38705

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys

Family

bZIP

Protein Properties

Length: 165aa MW: 18212.4 Da PI: 9.8983

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PH01001056G0170	genome	ICBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	32.6	1.7e-10	7	65	5	63
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 kr +r NR +A rs +RK +i+eLe+kv+ L++e ++L +l l+ +a l +++ PH01001056G0170 7 KRVKRVLANRQSAARSKERKMRYIAELEQKVQILQTEATRLSTQLALLQRDSAGLATQN 65 999*********************************************99998887766 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	9.6E-17	3	67	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.875	5	68	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	2.6E-11	7	64	No hit	No description
Pfam	PF00170	1.4E-9	7	65	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	2.89E-11	7	58	No hit	No description
CDD	cd14703	4.59E-18	8	59	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 165 aa Download sequence Send to blast
MVLADPKRVK RVLANRQSAA RSKERKMRYI AELEQKVQIL QTEATRLSTQ LALLQRDSAG 60 LATQNNELKF RLQAMEQQAQ LRDALNEALT TEVQHLKIAT AELGNSCSSN GLSSADPTQR 120 SESDASIAAA GYNDTVLSTA TDSRTAQRRT MNQKNDYRDI WTGS*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor probably involved in vascular development and shoot tissue organization. Binds to the DNA sequence 5'-CCGAGTGTGCCCCTGG-3' present in the promoter region Box II of the phloem-specific rice tungro bacilliform virus (RTBV) promoter. May regulate tissue-specific expression of the RTBV promoter and virus replication. {ECO:0000269\|PubMed:11390974, ECO:0000269\|PubMed:12855676, ECO:0000269\|PubMed:14704272, ECO:0000269\|PubMed:9311985}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PH01001056G0170

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006649313.1	1e-64	PREDICTED: transcription factor RF2a-like
Refseq	XP_025796879.1	1e-62	transcription factor RF2b-like
Swissprot	Q69IL4	5e-44	RF2A_ORYSJ; Transcription factor RF2a
TrEMBL	J3LJI7	2e-63	J3LJI7_ORYBR; Uncharacterized protein
STRING	Pavir.J19159.1.p	8e-64	(Panicum virgatum)
STRING	OB03G12130.1	4e-64	(Oryza brachyantha)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP3536	35	76

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G21230.1	6e-46	bZIP family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Dai S,Zhang Z,Bick J,Beachy RN Essential role of the Box II cis element and cognate host factors in regulating the promoter of Rice tungro bacilliform virus. J. Gen. Virol., 2006. 87(Pt 3): p. 715-22 [PMID:16476995] Liu Y,Dai S,Beachy RN Role of the C-terminal domains of rice (Oryza sativa L.) bZIP proteins RF2a and RF2b in regulating transcription. Biochem. J., 2007. 405(2): p. 243-9 [PMID:17371296] Dai S, et al. Transgenic rice plants that overexpress transcription factors RF2a and RF2b are tolerant to rice tungro virus replication and disease. Proc. Natl. Acad. Sci. U.S.A., 2008. 105(52): p. 21012-6 [PMID:19104064] Ordiz MI,Yang J,Barbazuk WB,Beachy RN Functional analysis of the activation domain of RF2a, a rice transcription factor. Plant Biotechnol. J., 2010. 8(7): p. 835-44 [PMID:20408988]