![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PH01001236G0110 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 162aa MW: 17519.5 Da PI: 6.5101 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 173.8 | 1.7e-54 | 23 | 118 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
+eqdr+lPianv+rimk++lP nakisk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa++ lGf+ yv+p++ yl+kyreleg
PH01001236G0110 23 KEQDRLLPIANVGRIMKQILPPNAKISKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDVCWAFGALGFDGYVDPMRRYLHKYRELEG 116
89******************************************************************************************** PP
NF-YB 96 ek 97
++
PH01001236G0110 117 DR 118
97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 1.7E-50 | 19 | 124 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.02E-38 | 25 | 124 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 4.3E-27 | 28 | 91 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 4.0E-17 | 56 | 74 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 59 | 75 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 4.0E-17 | 75 | 93 | No hit | No description |
| PRINTS | PR00615 | 4.0E-17 | 94 | 112 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 162 aa Download sequence Send to blast |
MADHHNQLGG SPDMAAAAGE EIKEQDRLLP IANVGRIMKQ ILPPNAKISK EAKETMQECV 60 SEFISFVTGE ASDKCHKEKR KTVNGDDVCW AFGALGFDGY VDPMRRYLHK YRELEGDRAA 120 AAASSRGGPD HPSTSGAGAS GTGHFMFNAM ERSDNNSSRQ F* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 3e-43 | 22 | 113 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 3e-43 | 22 | 113 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PH01001236G0110 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AK242118 | 1e-138 | AK242118.1 Oryza sativa Japonica Group cDNA, clone: J075146M01, full insert sequence. | |||
| GenBank | HG670306 | 1e-138 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015635864.1 | 3e-80 | nuclear transcription factor Y subunit B-1 | ||||
| Refseq | XP_015635872.1 | 3e-80 | nuclear transcription factor Y subunit B-1 | ||||
| Swissprot | Q75IZ7 | 3e-56 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A2WYT1 | 9e-80 | A2WYT1_ORYSI; Uncharacterized protein | ||||
| STRING | ORUFI01G46550.1 | 1e-79 | (Oryza rufipogon) | ||||
| STRING | OS01T0935200-01 | 1e-79 | (Oryza sativa) | ||||
| STRING | ORGLA01G0368700.1 | 1e-79 | (Oryza glaberrima) | ||||
| STRING | OBART01G43130.1 | 1e-79 | (Oryza barthii) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP2917 | 38 | 87 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 3e-57 | nuclear factor Y, subunit B5 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




