PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PH01002105G0310

Organism

Phyllostachys heterocycla

Taxonomic ID

38705

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys

Family

DBB

Protein Properties

Length: 200aa MW: 21214.8 Da PI: 6.2225

Description

DBB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PH01002105G0310	genome	ICBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-B_box	20	1.4e-06	4	43	5	38
zf-B_box 5 kCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38 C+ + + ++ fC ++ lC+ C H+ H+ PH01002105G0310 4 QCDVCAAEAASVFCCADEAALCDGCDRRVHRAnklsgkHR 43 7*****************************7677777776 PP
2	zf-B_box	24	8.1e-08	63	93	4	34
zf-B_box 4 rkCpeHeekelqlfCedCqqllCedClleeH 34 + C+ ++ek+ lfC++++ lC++C + H PH01002105G0310 63 PLCDICQEKRGFLFCKEDRAILCRECDVPVH 93 78************************99887 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00336	2.1E-9	1	47	IPR000315	B-box-type zinc finger
PROSITE profile	PS50119	9.556	1	47	IPR000315	B-box-type zinc finger
CDD	cd00021	6.63E-5	3	45	No hit	No description
Pfam	PF00643	3.2E-5	4	44	IPR000315	B-box-type zinc finger
SMART	SM00336	5.9E-12	60	107	IPR000315	B-box-type zinc finger
PROSITE profile	PS50119	9.556	60	107	IPR000315	B-box-type zinc finger
Pfam	PF00643	2.2E-6	62	94	IPR000315	B-box-type zinc finger
CDD	cd00021	4.23E-7	63	93	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009641	Biological Process	shade avoidance
GO:0005622	Cellular Component	intracellular
GO:0008270	Molecular Function	zinc ion binding

Sequence ? help Back to Top
Protein Sequence Length: 200 aa Download sequence Send to blast
MRVQCDVCAA EAASVFCCAD EAALCDGCDR RVHRANKLSG KHRRFSLLYP SPSSSASTQP 60 PRPLCDICQE KRGFLFCKED RAILCRECDV PVHMASKLTM RHSRFLLTGV RLSSEPAASP 120 APPSEEENSS SFCCSGDDVA PPVPATSHGG SSSISEYLIK TLPGWHVEDF LVDDASAAAA 180 AAAATSTGIS SDGSYQVGAR

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that acts as positive regulator of seedling photomorphogenesis (PubMed:17965270). Acts downstream of COP1 and play an important role in early and long-term adjustment of the shade avoidance syndrome (SAS) responses in natural environments (PubMed:21070414). {ECO:0000269\|PubMed:17965270, ECO:0000269\|PubMed:21070414}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PH01002105G0310

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	FP100160	0.0	FP100160.1 Phyllostachys edulis cDNA clone: bphylf049i09, full insert sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006648883.1	3e-95	PREDICTED: LOW QUALITY PROTEIN: B-box zinc finger protein 20-like
Swissprot	Q9LQZ7	1e-55	BBX21_ARATH; B-box zinc finger protein 21
TrEMBL	A0A0E0CP40	1e-95	A0A0E0CP40_9ORYZ; Uncharacterized protein
STRING	OMERI02G24530.1	3e-94	(Oryza meridionalis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP2392	36	79

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G75540.1	2e-51	salt tolerance homolog2

Publications ? help Back to Top
Xu D, et al. BBX21, an Arabidopsis B-box protein, directly activates HY5 and is targeted by COP1 for 26S proteasome-mediated degradation. Proc. Natl. Acad. Sci. U.S.A., 2016. 113(27): p. 7655-60 [PMID:27325768] Xu DB, et al. The G-Protein β Subunit AGB1 Promotes Hypocotyl Elongation through Inhibiting Transcription Activation Function of BBX21 in Arabidopsis. Mol Plant, 2017. 10(9): p. 1206-1223 [PMID:28827171] Xu D,Jiang Y,Li J,Holm M,Deng XW The B-Box Domain Protein BBX21 Promotes Photomorphogenesis. Plant Physiol., 2018. 176(3): p. 2365-2375 [PMID:29259103] Job N,Yadukrishnan P,Bursch K,Datta S,Johansson H Two B-Box Proteins Regulate Photomorphogenesis by Oppositely Modulating HY5 through their Diverse C-Terminal Domains. Plant Physiol., 2018. 176(4): p. 2963-2976 [PMID:29439209] Crocco CD,Ocampo GG,Ploschuk EL,Mantese A,Botto JF Heterologous Expression of AtBBX21 Enhances the Rate of Photosynthesis and Alleviates Photoinhibition in Solanumtuberosum. Plant Physiol., 2018. 177(1): p. 369-380 [PMID:29555784] Kang X, et al. HRB2 and BBX21 interaction modulates Arabidopsis ABI5 locus and stomatal aperture. Plant Cell Environ., 2018. 41(8): p. 1912-1925 [PMID:29748960]