![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PH01002755G0230 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 105aa MW: 11303.1 Da PI: 11.0338 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 92.3 | 2.4e-29 | 43 | 92 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
rie+ + rqvtfskRr g+lKKA+ELSvLCdaeva+i+fs++g+lye++s
PH01002755G0230 43 RIEDATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIVFSPRGRLYEFAS 92
8***********************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 6.1E-36 | 34 | 93 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 29.857 | 34 | 94 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 3.4E-27 | 36 | 94 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 36 | 90 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.1E-29 | 36 | 56 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 6.3E-27 | 43 | 90 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 5.64E-32 | 44 | 92 | No hit | No description |
| PRINTS | PR00404 | 2.1E-29 | 56 | 71 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.1E-29 | 71 | 92 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 105 aa Download sequence Send to blast |
MVATAAAAAR GEGQQIVAAP TPADSTVKAV KKTGRRGRRE MRRIEDATSR QVTFSKRRSG 60 LLKKAFELSV LCDAEVALIV FSPRGRLYEF ASATEYVRGL ISVC* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3mu6_A | 6e-18 | 36 | 93 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 3mu6_B | 6e-18 | 36 | 93 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 3mu6_C | 6e-18 | 36 | 93 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| 3mu6_D | 6e-18 | 36 | 93 | 2 | 59 | Myocyte-specific enhancer factor 2A |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. | |||||
| UniProt | Probable transcription factor. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PH01002755G0230 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FP098509 | 1e-141 | FP098509.1 Phyllostachys edulis cDNA clone: bphylf003i12, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_026380236.1 | 3e-30 | MADS-box protein SOC1-like isoform X1 | ||||
| Swissprot | A2Z9Q7 | 1e-30 | MAD56_ORYSI; MADS-box transcription factor 56 | ||||
| Swissprot | P0C5B2 | 1e-30 | MAD56_ORYSJ; MADS-box transcription factor 56 | ||||
| TrEMBL | A0A1E5VTG7 | 4e-36 | A0A1E5VTG7_9POAL; MADS-box protein SOC1 | ||||
| STRING | Traes_1BL_F1D5BF5F8.2 | 1e-31 | (Triticum aestivum) | ||||
| STRING | Traes_6DS_2BAD7A60A.1 | 9e-32 | (Triticum aestivum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP129 | 38 | 398 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G11880.1 | 6e-28 | AGAMOUS-like 14 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




