![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PH01003365G0100 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 122aa MW: 13318.1 Da PI: 9.5322 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 58.8 | 7.4e-19 | 21 | 55 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C+ Cgtt+Tp+WR gp +++LCnaCG++yrkk++
PH01003365G0100 21 CVECGTTTTPMWRGGPTRPRSLCNACGIRYRKKRR 55
********************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00401 | 2.1E-13 | 15 | 65 | IPR000679 | Zinc finger, GATA-type |
| PROSITE profile | PS50114 | 11.833 | 15 | 51 | IPR000679 | Zinc finger, GATA-type |
| SuperFamily | SSF57716 | 2.52E-13 | 19 | 56 | No hit | No description |
| Gene3D | G3DSA:3.30.50.10 | 2.5E-15 | 19 | 56 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 6.02E-13 | 20 | 56 | No hit | No description |
| Pfam | PF00320 | 9.1E-17 | 21 | 55 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 21 | 46 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 122 aa Download sequence Send to blast |
MGPSDRKVCG IGVVEEGRTS CVECGTTTTP MWRGGPTRPR SLCNACGIRY RKKRRQELGL 60 DQKQQQHHGE ATTEVKDSNS NSSSSSSNLQ VVQKRRLLMG VEEAAFLLMT LSSPPSSTLL 120 HG |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | PH01003365G0100 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FP096226 | 0.0 | FP096226.1 Phyllostachys edulis cDNA clone: bphyst038a02, full insert sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003567660.1 | 1e-55 | GATA transcription factor 23 | ||||
| Swissprot | Q8LC59 | 7e-17 | GAT23_ARATH; GATA transcription factor 23 | ||||
| TrEMBL | A0A0E0JI39 | 3e-54 | A0A0E0JI39_ORYPU; Uncharacterized protein | ||||
| TrEMBL | I1HF65 | 3e-54 | I1HF65_BRADI; Uncharacterized protein | ||||
| STRING | BRADI2G12590.1 | 5e-55 | (Brachypodium distachyon) | ||||
| STRING | OPUNC01G14080.1 | 5e-55 | (Oryza punctata) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Monocots | OGMP6721 | 28 | 54 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G26930.1 | 9e-18 | GATA transcription factor 23 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




