PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PH01190367G0010

Organism

Phyllostachys heterocycla

Taxonomic ID

38705

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys

Family

GRAS

Protein Properties

Length: 158aa MW: 17095.7 Da PI: 7.559

Description

GRAS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PH01190367G0010	genome	ICBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	GRAS	190.3	1.3e-58	6	158	1	160
GRAS 1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl...fsevsPil 91 lv++Ll+cAeav++++l++a+a+++++ la+++g +m+++aayf eALa+r++r ++p+++s + ++++a+ l f+e +P+l PH01190367G0010 6 LVHALLACAEAVQQENLTAAEAVVKQIPLLAASQGGAMRKVAAYFGEALARRVYR--------FRPTPDS--SLLDAAFADLLhahFYESCPYL 89 689**************************************************........4444444..34444444444446**** PP GRAS 92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeelee 160 kf+h+taNqaIlea++g++rvH++Df+i+qG+QWpaLlqaLa Rp+gpps+R+Tgvg+p+++++++l++ PH01190367G0010 90 KFAHFTANQAILEAFAGCRRVHVVDFGIKQGMQWPALLQALALRPGGPPSFRLTGVGPPQPDETDALQQ 158 ***********************************************************99999885 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50985	37.451	1	158	IPR005202	Transcription factor GRAS
Pfam	PF03514	4.5E-56	6	158	IPR005202	Transcription factor GRAS

Sequence ? help Back to Top
Protein Sequence Length: 158 aa Download sequence Send to blast
EAGIRLVHAL LACAEAVQQE NLTAAEAVVK QIPLLAASQG GAMRKVAAYF GEALARRVYR 60 FRPTPDSSLL DAAFADLLHA HFYESCPYLK FAHFTANQAI LEAFAGCRRV HVVDFGIKQG 120 MQWPALLQAL ALRPGGPPSF RLTGVGPPQP DETDALQQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5b3g_A	1e-28	1	146	14	166	Protein SCARECROW
5b3h_A	1e-28	1	146	13	165	Protein SCARECROW
5b3h_D	1e-28	1	146	13	165	Protein SCARECROW
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway.
UniProt	Probable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway. Acts as a negative regulator of GAMYB gene expression. {ECO:0000269\|PubMed:12011349, ECO:0000269\|PubMed:12011350, ECO:0000269\|PubMed:12468736}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PH01190367G0010

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	FR668587	0.0	FR668587.1 Triticum aestivum rht-B1 gene, allele h.
GenBank	JF930279	0.0	JF930279.1 Triticum aestivum DELLA protein (Rht-B1) gene, Rht-B1c allele, complete cds.
GenBank	JX993610	0.0	JX993610.1 Triticum aestivum cultivar Kanred bio-material JIC:741 haplotype Rht-B1a_5 DELLA protein (Rht-B1) gene, complete cds.
GenBank	JX993611	0.0	JX993611.1 Triticum aestivum cultivar Arawa bio-material INRA:00957 haplotype Rht-B1a_6 DELLA protein (Rht-B1) gene, complete cds.
GenBank	JX993617	0.0	JX993617.1 Triticum aestivum cultivar SS7010073 bio-material JIC:7010073 haplotype Rht-B1a_12 DELLA protein (Rht-B1) gene, complete cds.
GenBank	JX993618	0.0	JX993618.1 Triticum dicoccoides cultivar 65 bio-material USDA:PI428097 haplotype Rht-B1a_13 DELLA protein (Rht-B1) gene, complete cds.
GenBank	JX993619	0.0	JX993619.1 Triticum dicoccoides cultivar 57 bio-material USDA:PI428054 haplotype Rht-B1a_14 DELLA protein (Rht-B1) gene, complete cds.
GenBank	KC434134	0.0	KC434134.1 Triticum aestivum cultivar Maringa DELLA (Rht-B1) gene, Rht-B1c allele, complete cds.
GenBank	KC434135	0.0	KC434135.1 Triticum aestivum cultivar Maringa DELLA (Rht-B1) mRNA, Rht-B1c allele, complete cds.
GenBank	KC614607	0.0	KC614607.1 Triticum aestivum cultivar Auguste bio-material INRA:13861 haplotype Rht-B1a_6 DELLA protein (Rht-B1) gene, complete cds.
GenBank	KC614608	0.0	KC614608.1 Triticum aestivum cultivar Cappelle Desprez bio-material NIAB EW3 haplotype Rht-B1a_6 DELLA protein (Rht-B1) gene, complete cds.
GenBank	KC614609	0.0	KC614609.1 Triticum aestivum cultivar Hobbit 'Sib' bio-material NIAB EW7 haplotype Rht-B1a_6 DELLA protein (Rht-B1) gene, complete cds.
GenBank	KC767926	0.0	KC767926.1 Triticum aestivum cultivar Sumai 3 DELLA (Rht-B1) gene, Rht-B1c allele, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020147810.1	1e-105	DELLA protein RHT-1
Swissprot	Q8W127	1e-106	SLN1_HORVU; DELLA protein SLN1
Swissprot	Q9ST59	1e-106	RHT1_WHEAT; DELLA protein RHT-1
TrEMBL	C0LG58	1e-106	C0LG58_ZEALU; Gibberelin response modulator dwarf 8 (Fragment)
TrEMBL	Q6R4G7	1e-107	Q6R4G7_ZEAMP; Gibberelin response modulator dwarf 8 (Fragment)
STRING	MLOC_67940.1	1e-106	(Hordeum vulgare)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP998	38	138

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G14920.1	7e-73	GRAS family protein

Publications ? help Back to Top
Wilhelm EP, et al. Genetic characterization and mapping of the Rht-1 homoeologs and flanking sequences in wheat. Theor. Appl. Genet., 2013. 126(5): p. 1321-36 [PMID:23381809]