PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PH01276401G0010

Organism

Phyllostachys heterocycla

Taxonomic ID

38705

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys

Family

bZIP

Protein Properties

Length: 83aa MW: 9253.15 Da PI: 10.8181

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PH01276401G0010	genome	ICBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	45.3	1.9e-14	24	79	5	60
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 ++ +r+ +NRe+ArrsR+RK++++eeL +++ L+aeN + ++ + e k++ PH01276401G0010 24 RKRKRMLSNRESARRSRARKQQRLEELIAEAARLQAENARAEAQIGAYARELGKVD 79 678999********************************988877777777666655 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	3.4E-14	20	83	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	1.2E-14	21	77	No hit	No description
PROSITE profile	PS50217	11.323	22	83	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	1.5E-10	24	72	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	2.31E-11	24	76	No hit	No description
PROSITE pattern	PS00036	0	27	42	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 83 aa Download sequence Send to blast
MSSRRSTSPE SGNTDGSGYT ADERKRKRML SNRESARRSR ARKQQRLEEL IAEAARLQAE 60 NARAEAQIGA YARELGKVDG ENA

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	36	43	RRSRARKQ

Functional Description ? help Back to Top
Source	Description
UniProt	May contribute to developmentally specific patterns of gene expression. Binds specifically to ocs elements which are transcriptional enhancer found in the promoters of several plant genes. OCSBF-1 is able to bind to a site within each half of the ocs element as well as to animal AP-1 and CREB sites.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PH01276401G0010

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	FP096162	1e-137	FP096162.1 Phyllostachys edulis cDNA clone: bphylf050n09, full insert sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006654003.1	8e-29	PREDICTED: ocs element-binding factor 1-like
Swissprot	P24068	3e-15	OCS1_MAIZE; Ocs element-binding factor 1
TrEMBL	J3M3N5	2e-27	J3M3N5_ORYBR; Uncharacterized protein
STRING	OB05G12090.1	3e-28	(Oryza brachyantha)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1886	35	100

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G62420.1	4e-08	basic region/leucine zipper motif 53

Publications ? help Back to Top
Singh K, et al. OCSBF-1, a maize ocs enhancer binding factor: isolation and expression during development. Plant Cell, 1990. 2(9): p. 891-903 [PMID:2152133]