PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PK00393.1

Organism

Cannabis sativa

Taxonomic ID

3483

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis

Family

SBP

Protein Properties

Length: 66aa MW: 7562.28 Da PI: 9.1547

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PK00393.1	genome	CCBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	68	1.9e-21	18	64	2	48
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 C v+gC++dl+++ +yhrrhkvCe+hsk+p+v++ g+eqrf qqCsr PK00393.1 18 CLVDGCNSDLTKCWDYHRRHKVCETHSKTPKVTIGGHEQRFYQQCSR 64 **********************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.1100.10	1.2E-22	11	64	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	17.956	15	66	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	1.96E-20	16	65	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	3.8E-15	18	64	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 66 aa Download sequence Send to blast
XKRTRGPSSN NGIHVPSCLV DGCNSDLTKC WDYHRRHKVC ETHSKTPKVT IGGHEQRFYQ 60 QCSRCV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj0_A	5e-15	18	64	6	52	squamosa promoter-binding protein-like 12
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305\|PubMed:16861571}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_026385455.1	1e-26	squamosa promoter-binding-like protein 16
Swissprot	Q6YZE8	4e-21	SPL16_ORYSJ; Squamosa promoter-binding-like protein 16
TrEMBL	A0A2P5C1R1	9e-27	A0A2P5C1R1_TREOI; SBP-box transcription factor
STRING	XP_010090650.1	9e-25	(Morus notabilis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31898	2	2

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G50670.1	2e-21	SBP family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Wang SS,Wang CS,Tseng TH,Hou YL,Chen KY High-resolution genetic mapping and candidate gene identification of the SLP1 locus that controls glume development in rice. Theor. Appl. Genet., 2011. 122(8): p. 1489-96 [PMID:21327937] Wang S, et al. Control of grain size, shape and quality by OsSPL16 in rice. Nat. Genet., 2012. 44(8): p. 950-4 [PMID:22729225] Wang S, et al. The OsSPL16-GW7 regulatory module determines grain shape and simultaneously improves rice yield and grain quality. Nat. Genet., 2015. 47(8): p. 949-54 [PMID:26147620] Wang Y, et al. A comprehensive meta-analysis of plant morphology, yield, stay-green, and virus disease resistance QTL in maize (Zea mays L.). Planta, 2016. 243(2): p. 459-71 [PMID:26474992] Lee CM, et al. Influence of Multi-Gene Allele Combinations on Grain Size of Rice and Development of a Regression Equation Model to Predict Grain Parameters. Rice (N Y), 2015. 8(1): p. 33 [PMID:26519289] Bessho-Uehara K, et al. Loss of function at RAE2, a previously unidentified EPFL, is required for awnlessness in cultivated Asian rice. Proc. Natl. Acad. Sci. U.S.A., 2016. 113(32): p. 8969-74 [PMID:27466405]