![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PK01153.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 74aa MW: 8411.34 Da PI: 10.6112 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 61.6 | 1.6e-19 | 28 | 70 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
++T+eEd +++a++ +G++ W+tIar ++ gRt++ +k++w++
PK01153.2 28 PFTPEEDSMIIQAHAAHGNK-WATIARLLP-GRTDNAIKNHWNST 70
89******************.*********.***********986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 1.88E-23 | 8 | 72 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 5.4E-8 | 9 | 33 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 23.18 | 21 | 74 | IPR017930 | Myb domain |
| SMART | SM00717 | 2.1E-14 | 25 | 73 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.04E-13 | 28 | 71 | No hit | No description |
| Pfam | PF00249 | 7.8E-17 | 28 | 70 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 4.3E-23 | 34 | 71 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 74 aa Download sequence Send to blast |
XRVRPSYGGK SCRLRWCNQL CPSVQHRPFT PEEDSMIIQA HAAHGNKWAT IARLLPGRTD 60 NAIKNHWNST LQIG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1gv2_A | 3e-24 | 9 | 72 | 39 | 102 | MYB PROTO-ONCOGENE PROTEIN |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in auxin response. Functions in auxin signal transduction and modulates lateral root growth. Interacts with ARF response factors to promote auxin-responsive gene expression (PubMed:17675404). In response to auxin, binds sequence-specific motifs in the promoter of the auxin-responsive gene IAA19, and activates IAA19 transcription. The IAA19 transcription activation by MYB77 is enhanced by direct interaction between MYB77 and PYL8 (PubMed:24894996). {ECO:0000269|PubMed:17675404, ECO:0000269|PubMed:24894996}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by auxin (PubMed:17675404). Down-regulated by potassium deprivation (PubMed:15173595). {ECO:0000269|PubMed:15173595, ECO:0000269|PubMed:17675404}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008369404.1 | 5e-38 | transcription factor MYB73-like | ||||
| Swissprot | Q9SN12 | 5e-33 | MYB77_ARATH; Transcription factor MYB77 | ||||
| TrEMBL | A0A392NFN6 | 2e-36 | A0A392NFN6_9FABA; Transcription factor MYB44-like (Fragment) | ||||
| TrEMBL | A0A498JGK3 | 1e-36 | A0A498JGK3_MALDO; Uncharacterized protein | ||||
| STRING | XP_008369404.1 | 2e-37 | (Malus domestica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF11600 | 29 | 35 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G50060.1 | 2e-35 | myb domain protein 77 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




