![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PK01183.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 63aa MW: 7130.81 Da PI: 8.2199 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 53 | 8e-17 | 18 | 62 | 1 | 45 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
+g+WT eEd++l+++++ +G g W++ a+ g++Rt+k+c++rw+
PK01183.1 18 KGPWTMEEDLILINYIANHGEGVWNSLAKAAGLKRTGKSCRLRWL 62
79******************************************6 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 3.2E-19 | 11 | 61 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 7.25E-14 | 13 | 62 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 18.148 | 13 | 63 | IPR017930 | Myb domain |
| SMART | SM00717 | 8.0E-5 | 17 | 63 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.8E-15 | 18 | 62 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 5.16E-9 | 20 | 61 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 63 aa Download sequence Send to blast |
DYTRTCSGNS SEEVEVRKGP WTMEEDLILI NYIANHGEGV WNSLAKAAGL KRTGKSCRLR 60 WLX |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor involved in photomorphogenesis in the light. May act downstream of the light receptor network and directly affects transcription of light-induced genes. In darkness, its probable degradation prevent the activation of light-induced genes. Required to activate expression of PAL. Acts redundantly with MYB24 and MYB57 to control stamen filament elongation in the late developed flowers. Contributes with MYB24 to induction of MYB108 by jasmonate. Repressed at the transcript levels by DELLA proteins. {ECO:0000269|PubMed:11967090, ECO:0000269|PubMed:16805732, ECO:0000269|PubMed:19091873, ECO:0000269|PubMed:19325888, ECO:0000269|PubMed:21447791}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated by jasmonate. {ECO:0000269|PubMed:16805732}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015879077.1 | 2e-30 | myb-related protein 305-like | ||||
| Swissprot | Q9LK95 | 1e-28 | MYB21_ARATH; Transcription factor MYB21 | ||||
| TrEMBL | A0A2P5BUN1 | 1e-30 | A0A2P5BUN1_PARAD; MYB transcription factor | ||||
| STRING | XP_008443525.1 | 9e-30 | (Cucumis melo) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF3305 | 34 | 69 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G27810.1 | 5e-31 | myb domain protein 21 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




