![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PK02473.3 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 70aa MW: 7568.12 Da PI: 4.1651 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 28.4 | 4.4e-09 | 36 | 69 | 2 | 35 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHH CS
HSF_DNA-bind 2 Flkklyeiledeelkeliswsengnsfvvldeee 35
Fl+k++e++ed++++ ++sws nsfvv+d+++
PK02473.3 36 FLTKTFEMVEDPSTDAIVSWSIARNSFVVWDSHQ 69
9********************888******9875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 3.1E-10 | 29 | 69 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SuperFamily | SSF46785 | 2.31E-7 | 32 | 68 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF00447 | 2.5E-6 | 36 | 69 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 70 aa Download sequence Send to blast |
FVGTGSSSSS SSNNQSPPPI MVQPMEGLHD VGPPPFLTKT FEMVEDPSTD AIVSWSIARN 60 SFVVWDSHQX |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically binds heat shock promoter elements (HSE) and activates transcription. {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_026449317.1 | 4e-25 | heat stress transcription factor A-7a-like | ||||
| Swissprot | P41152 | 1e-22 | HSF30_SOLPE; Heat shock factor protein HSF30 | ||||
| TrEMBL | A0A2P5FE00 | 6e-24 | A0A2P5FE00_TREOI; Heat shock transcription factor | ||||
| STRING | EMJ24510 | 3e-23 | (Prunus persica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1592 | 33 | 95 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G26150.1 | 3e-23 | heat shock transcription factor A2 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




