![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PK03912.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
| Family | HD-ZIP | ||||||||
| Protein Properties | Length: 103aa MW: 12345.1 Da PI: 10.6404 | ||||||||
| Description | HD-ZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 64.9 | 1.1e-20 | 16 | 68 | 4 | 56 |
-SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
Homeobox 4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
++f++eq+++Le+ Fe++ ++ +++ +LA++lgL+ +qV +WFqNrRa++k
PK03912.2 16 QRRFSDEQIKQLESIFESETKLEPKKKIQLARELGLQPKQVAIWFQNRRARWK 68
579*************************************************9 PP
| |||||||
| 2 | HD-ZIP_I/II | 122.5 | 2e-39 | 15 | 101 | 2 | 88 |
HD-ZIP_I/II 2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88
++rr+s+eq+k+LE+ Fe+e+kLep++K +lareLglqp+qva+WFqnrRAR+k+kq+E+d++ L+++yd+l+++ ++L++e+++L
PK03912.2 15 NQRRFSDEQIKQLESIFESETKLEPKKKIQLARELGLQPKQVAIWFQNRRARWKSKQIEQDFKNLRAEYDNLVSQFDSLKQEKDSLV 101
68*********************************************************************************9996 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50071 | 17.572 | 10 | 70 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 5.99E-19 | 10 | 71 | IPR009057 | Homeodomain-like |
| SMART | SM00389 | 2.0E-17 | 13 | 74 | IPR001356 | Homeobox domain |
| Gene3D | G3DSA:1.10.10.60 | 1.1E-20 | 16 | 76 | IPR009057 | Homeodomain-like |
| Pfam | PF00046 | 4.9E-18 | 16 | 68 | IPR001356 | Homeobox domain |
| CDD | cd00086 | 2.74E-13 | 16 | 71 | No hit | No description |
| PRINTS | PR00031 | 2.6E-6 | 41 | 50 | IPR000047 | Helix-turn-helix motif |
| PROSITE pattern | PS00027 | 0 | 45 | 68 | IPR017970 | Homeobox, conserved site |
| PRINTS | PR00031 | 2.6E-6 | 50 | 66 | IPR000047 | Helix-turn-helix motif |
| Pfam | PF02183 | 7.2E-11 | 70 | 102 | IPR003106 | Leucine zipper, homeobox-associated |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 103 aa Download sequence Send to blast |
LIPISKKKKN NNSNNQRRFS DEQIKQLESI FESETKLEPK KKIQLARELG LQPKQVAIWF 60 QNRRARWKSK QIEQDFKNLR AEYDNLVSQF DSLKQEKDSL VLQ |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 62 | 70 | RRARWKSKQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription activator that may act as growth regulators in response to water deficit. {ECO:0000269|PubMed:15604708, ECO:0000269|PubMed:8771791}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By water deficit, by abscisic acid (ABA) and by salt stress. {ECO:0000269|PubMed:16055682, ECO:0000269|PubMed:8771791}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021805522.1 | 1e-47 | homeobox-leucine zipper protein ATHB-12-like | ||||
| Swissprot | P46897 | 5e-45 | ATHB7_ARATH; Homeobox-leucine zipper protein ATHB-7 | ||||
| TrEMBL | A0A314XMA3 | 4e-46 | A0A314XMA3_PRUYE; Homeobox-leucine zipper protein ATHB-12 | ||||
| STRING | EMJ19568 | 1e-46 | (Prunus persica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF12005 | 26 | 35 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G46680.1 | 1e-42 | homeobox 7 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




