PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK04961.2
Organism
Cannabis sativa
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 60aa    MW: 7210.12 Da    PI: 4.5639
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK04961.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM39.61.7e-12240948
        NAM  9 PtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
               Pt+eel+++yLkkkv++++++l +vi++vd++k+ePwd++
  PK04961.2  2 PTEEELLQYYLKKKVSNQSIDL-DVIRDVDLNKLEPWDIQ 40
               **********************.9**************97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100513.727160IPR003441NAC domain
PfamPF023651.6E-4245IPR003441NAC domain
SuperFamilySSF1019417.06E-12243IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 60 aa     Download sequence    Send to blast
XPTEEELLQY YLKKKVSNQS IDLDVIRDVD LNKLEPWDIQ GIFIYLIIFL HTRCGTIYIY
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008233055.14e-20PREDICTED: NAC domain-containing protein 43
RefseqXP_021815062.14e-20NAC domain-containing protein 43
SwissprotQ84WP69e-18NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A251QLN21e-18A0A251QLN2_PRUPE; Uncharacterized protein
TrEMBLA0A2P5BI271e-18A0A2P5BI27_TREOI; NAC domain containing protein
TrEMBLA0A2P5DQD11e-18A0A2P5DQD1_PARAD; NAC domain containing protein
TrEMBLA0A314XZA61e-18A0A314XZA6_PRUYE; Uncharacterized protein
TrEMBLA0A4D9AQ665e-19A0A4D9AQ66_SALSN; Uncharacterized protein
TrEMBLM5X7Y19e-19M5X7Y1_PRUPE; Uncharacterized protein
STRINGXP_008233055.12e-19(Prunus mume)
STRINGEMJ220542e-19(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114331739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.14e-20NAC family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Gondolf VM, et al.
    A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 344
    [PMID:25492673]
  3. Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ
    A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons.
    GM Crops Food, 2014. 5(4): p. 302-20
    [PMID:25523176]
  4. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  5. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  6. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]
  7. Liu C,Yu H,Li L
    SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana.
    PLoS Genet., 2019. 15(1): p. e1007928
    [PMID:30657769]