![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PK04961.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 60aa MW: 7210.12 Da PI: 4.5639 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 39.6 | 1.7e-12 | 2 | 40 | 9 | 48 |
NAM 9 PtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
Pt+eel+++yLkkkv++++++l +vi++vd++k+ePwd++
PK04961.2 2 PTEEELLQYYLKKKVSNQSIDL-DVIRDVDLNKLEPWDIQ 40
**********************.9**************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 13.727 | 1 | 60 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.6E-4 | 2 | 45 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 7.06E-12 | 2 | 43 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 60 aa Download sequence Send to blast |
XPTEEELLQY YLKKKVSNQS IDLDVIRDVD LNKLEPWDIQ GIFIYLIIFL HTRCGTIYIY |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008233055.1 | 4e-20 | PREDICTED: NAC domain-containing protein 43 | ||||
| Refseq | XP_021815062.1 | 4e-20 | NAC domain-containing protein 43 | ||||
| Swissprot | Q84WP6 | 9e-18 | NAC43_ARATH; NAC domain-containing protein 43 | ||||
| TrEMBL | A0A251QLN2 | 1e-18 | A0A251QLN2_PRUPE; Uncharacterized protein | ||||
| TrEMBL | A0A2P5BI27 | 1e-18 | A0A2P5BI27_TREOI; NAC domain containing protein | ||||
| TrEMBL | A0A2P5DQD1 | 1e-18 | A0A2P5DQD1_PARAD; NAC domain containing protein | ||||
| TrEMBL | A0A314XZA6 | 1e-18 | A0A314XZA6_PRUYE; Uncharacterized protein | ||||
| TrEMBL | A0A4D9AQ66 | 5e-19 | A0A4D9AQ66_SALSN; Uncharacterized protein | ||||
| TrEMBL | M5X7Y1 | 9e-19 | M5X7Y1_PRUPE; Uncharacterized protein | ||||
| STRING | XP_008233055.1 | 2e-19 | (Prunus mume) | ||||
| STRING | EMJ22054 | 2e-19 | (Prunus persica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF11433 | 17 | 39 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G46770.1 | 4e-20 | NAC family protein | ||||




