![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PK05671.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 102aa MW: 11122.6 Da PI: 10.558 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 129.5 | 9.6e-41 | 42 | 101 | 2 | 61 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
++++lkcprCds ntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvPvGgg+rknkk+
PK05671.1 42 EQQSLKCPRCDSPNTKFCYYNNYSLTQPRHFCKTCRRYWTKGGALRNVPVGGGCRKNKKV 101
57899*****************************************************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 3.0E-27 | 32 | 100 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 3.8E-34 | 44 | 100 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 29.534 | 46 | 100 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 48 | 84 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010052 | Biological Process | guard cell differentiation | ||||
| GO:0010118 | Biological Process | stomatal movement | ||||
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
| GO:1902066 | Biological Process | regulation of cell wall pectin metabolic process | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 102 aa Download sequence Send to blast |
MMSADPAPAA APTKSASSKD EIHGTSAAGN RKNSSASRPA PEQQSLKCPR CDSPNTKFCY 60 YNNYSLTQPR HFCKTCRRYW TKGGALRNVP VGGGCRKNKK VK |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_029127523.1 | 8e-44 | dof zinc finger protein DOF5.7 | ||||
| Swissprot | Q9LSL6 | 3e-36 | DOF57_ARATH; Dof zinc finger protein DOF5.7 | ||||
| TrEMBL | A0A2P5AWK4 | 4e-52 | A0A2P5AWK4_PARAD; Zinc finger, Dof-type | ||||
| TrEMBL | A0A2P5FGY5 | 4e-52 | A0A2P5FGY5_TREOI; Zinc finger, Dof-type | ||||
| STRING | XP_007158346.1 | 5e-42 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF3854 | 34 | 60 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G65590.1 | 6e-38 | Dof family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




