PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PK05989.2

Organism

Cannabis sativa

Taxonomic ID

3483

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis

Family

bZIP

Protein Properties

Length: 105aa MW: 12527.3 Da PI: 10.769

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PK05989.2	genome	CCBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	35.3	2.6e-11	1	42	5	46
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLk 46 k+ rr +NR AA rsR+RKk++++eLe k+k Le+e ++L PK05989.2 1 KKRRRQVRNRDAAVRSRERKKMYVKELEMKSKYLEGECRRLG 42 7899*********************************98775 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF57959	6.88E-11	1	56	No hit	No description
Pfam	PF00170	1.5E-9	1	42	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.14	1	41	IPR004827	Basic-leucine zipper domain
SMART	SM00338	0.0049	1	61	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	3.3E-11	1	56	No hit	No description
CDD	cd14704	9.80E-13	2	53	No hit	No description
PROSITE pattern	PS00036	0	4	19	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 105 aa Download sequence Send to blast
KKRRRQVRNR DAAVRSRERK KMYVKELEMK SKYLEGECRR LGRLLQFCYA ENQALRIASS 60 SSYAFGGSTT TKQESAVLFL GMYHHHHHHH FLFSFFGLYS FHNNI

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	1	20	KRRRQVRNRDAAVRSRERKK

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in endoplasmic reticulum (ER) stress response (PubMed:21223397, PubMed:22050533, PubMed:22199238). Acts downstream of the ER stress sensors IRE1, BZIP39 and BZIP60 to activate BiP chaperone genes (PubMed:22050533, PubMed:22199238). {ECO:0000269\|PubMed:21223397, ECO:0000269\|PubMed:22050533, ECO:0000269\|PubMed:22199238}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By dithiothreitol-induced endoplasmic reticulum (ER) stress response (PubMed:22050533, PubMed:21223397). Induced by salt stress (PubMed:22050533). {ECO:0000269\|PubMed:21223397, ECO:0000269\|PubMed:22050533}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	FR751556	3e-93	FR751556.1 Humulus lupulus mRNA for basic-leucine zipper (bZip4 gene), cultivar Osvald's 72, clone 3559.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008237894.1	9e-34	PREDICTED: bZIP transcription factor 60
Refseq	XP_021600280.1	2e-34	bZIP transcription factor 60-like
Refseq	XP_021815550.1	8e-34	bZIP transcription factor 60
Swissprot	Q69XV0	4e-24	BZP50_ORYSJ; bZIP transcription factor 50
TrEMBL	G7ZLA5	1e-39	G7ZLA5_HUMLU; Basic-leucine zipper
STRING	Lus10040069	9e-35	(Linum usitatissimum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF12009	30	32

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G42990.1	4e-07	basic region/leucine zipper motif 60

Publications ? help Back to Top
Wakasa Y, et al. Expression of ER quality control-related genes in response to changes in BiP1 levels in developing rice endosperm. Plant J., 2011. 65(5): p. 675-89 [PMID:21223397] Lu SJ, et al. Conservation of IRE1-regulated bZIP74 mRNA unconventional splicing in rice (Oryza sativa L.) involved in ER stress responses. Mol Plant, 2012. 5(2): p. 504-14 [PMID:22199238]