![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PK06427.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
| Family | WOX | ||||||||
| Protein Properties | Length: 84aa MW: 9706.42 Da PI: 11.0542 | ||||||||
| Description | WOX family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Homeobox | 47.6 | 2.9e-15 | 2 | 55 | 9 | 57 |
HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
Homeobox 9 keqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
+eq+++Le+ F++ +p ++e++++ ++l ++ +++V++WFqNr+ + k+
PK06427.1 2 PEQIRILEAIFNSgMVNPPRDEIRRIRAQLqeygQVGDANVFYWFQNRKSRSKH 55
79**********99*************************************995 PP
| |||||||
| 2 | Wus_type_Homeobox | 100.3 | 1.5e-32 | 2 | 56 | 10 | 64 |
Wus_type_Homeobox 10 peQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
peQi+iLe++++sG+++P+++ei+ri+a+L+eyG+++d+NVfyWFQNrk+R+++k
PK06427.1 2 PEQIRILEAIFNSGMVNPPRDEIRRIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 56
89***************************************************99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00389 | 0.0095 | 1 | 60 | IPR001356 | Homeobox domain |
| PROSITE profile | PS50071 | 10.463 | 1 | 56 | IPR001356 | Homeobox domain |
| SuperFamily | SSF46689 | 7.7E-11 | 2 | 60 | IPR009057 | Homeodomain-like |
| Pfam | PF00046 | 6.7E-13 | 2 | 55 | IPR001356 | Homeobox domain |
| Gene3D | G3DSA:1.10.10.60 | 1.9E-6 | 2 | 54 | IPR009057 | Homeodomain-like |
| CDD | cd00086 | 2.07E-5 | 2 | 56 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0008284 | Biological Process | positive regulation of cell proliferation | ||||
| GO:0009735 | Biological Process | response to cytokinin | ||||
| GO:0009793 | Biological Process | embryo development ending in seed dormancy | ||||
| GO:0010075 | Biological Process | regulation of meristem growth | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0005737 | Cellular Component | cytoplasm | ||||
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 84 aa Download sequence Send to blast |
XPEQIRILEA IFNSGMVNPP RDEIRRIRAQ LQEYGQVGDA NVFYWFQNRK SRSKHKLRHL 60 QNSIQQNLQN PTPTPPSSAT APSX |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Homeodomain transcription factor required for meristem growth and early development (PubMed:15753038). Promotes cell proliferation and prevents premature differentiation in meristematic tissues during postembryonic development (PubMed:15753038). Essential for maintaining tissue growth during embryogenesis (PubMed:17706632). May act by repressing TSS to promote meristematic proliferation (PubMed:21185286). Involved in the transcriptional activation of a subset of cytokinin response factors (PubMed:20110319). May act as a negative regulator of cytokinin signaling in the dark (PubMed:21057190). {ECO:0000269|PubMed:15753038, ECO:0000269|PubMed:17706632, ECO:0000269|PubMed:20110319, ECO:0000269|PubMed:21057190, ECO:0000303|PubMed:21185286}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated in the zygote after fertilization by the transcription factor WRKY2. {ECO:0000269|PubMed:21316593}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012092417.1 | 2e-41 | WUSCHEL-related homeobox 9 | ||||
| Refseq | XP_020230917.1 | 3e-41 | WUSCHEL-related homeobox 9 | ||||
| Refseq | XP_020541150.1 | 2e-41 | WUSCHEL-related homeobox 9 | ||||
| Swissprot | Q6X7J4 | 8e-35 | WOX9_ARATH; WUSCHEL-related homeobox 9 | ||||
| TrEMBL | A0A067JE43 | 5e-40 | A0A067JE43_JATCU; Uncharacterized protein | ||||
| TrEMBL | A0A151SAT5 | 5e-40 | A0A151SAT5_CAJCA; WUSCHEL-related homeobox 9 | ||||
| STRING | cassava4.1_023871m | 2e-39 | (Manihot esculenta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF3824 | 33 | 61 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G33880.1 | 8e-37 | homeobox-3 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




