![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PK06515.5 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 90aa MW: 10438.5 Da PI: 10.2815 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 42.4 | 1.6e-13 | 34 | 78 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
r +W +eE++++++a +++ + Wk+I +g +t q++s+ qky
PK06515.5 34 RESWAEEEHDKFLEALQLFDRD-WKKIEDFVG-SKTVIQIRSHAQKY 78
789*****************77.*********.*************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF46689 | 6.95E-17 | 28 | 84 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 15.439 | 29 | 83 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 8.9E-8 | 31 | 87 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 2.1E-18 | 32 | 81 | IPR006447 | Myb domain, plants |
| SMART | SM00717 | 4.3E-10 | 33 | 81 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 3.4E-11 | 34 | 78 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.98E-7 | 36 | 79 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 90 aa Download sequence Send to blast |
XKMNSNPSNN PQSTTPADAS AKKIRKPYTI TKSRESWAEE EHDKFLEALQ LFDRDWKKIE 60 DFVGSKTVIQ IRSHAQKYFQ KVQKNGTLAH |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator of evening element (EE)-containing clock-controlled genes. Forms a negative feedback loop with APRR5. Regulates the pattern of histone H3 acetylation of the TOC1 promoter. {ECO:0000269|PubMed:21205033, ECO:0000269|PubMed:21474993, ECO:0000269|PubMed:21483796, ECO:0000269|PubMed:23638299}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Circadian-regulation. Peak of expression in the afternoon. Down-regulated by cold. {ECO:0000269|PubMed:21205033, ECO:0000269|PubMed:22902701, ECO:0000269|PubMed:23638299}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024024228.1 | 2e-51 | protein REVEILLE 8 isoform X1 | ||||
| Refseq | XP_024024229.1 | 2e-51 | protein REVEILLE 8 isoform X1 | ||||
| Refseq | XP_024024230.1 | 2e-51 | protein REVEILLE 8 isoform X1 | ||||
| Refseq | XP_024024231.1 | 1e-51 | protein REVEILLE 8 isoform X2 | ||||
| Refseq | XP_024024233.1 | 1e-51 | protein REVEILLE 8 isoform X3 | ||||
| Swissprot | Q8RWU3 | 5e-46 | RVE8_ARATH; Protein REVEILLE 8 | ||||
| TrEMBL | W9RLU7 | 6e-50 | W9RLU7_9ROSA; Transcription factor ASG4 | ||||
| STRING | XP_010100834.1 | 1e-50 | (Morus notabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2956 | 33 | 72 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G09600.2 | 5e-45 | MYB_related family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




