![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PK09461.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
| Family | YABBY | ||||||||
| Protein Properties | Length: 68aa MW: 7497.37 Da PI: 5.313 | ||||||||
| Description | YABBY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | YABBY | 79.6 | 9.5e-25 | 6 | 64 | 3 | 61 |
YABBY 3 vfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaes 61
v+ ++eq+Cy+ CnfCn +lavsvP +slf +vtvrCGhCt+l svn+a a q l+ ++
PK09461.2 6 VDVAPEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAAFQSLSWQQ 64
67899********************************************9999887665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04690 | 3.1E-26 | 9 | 65 | IPR006780 | YABBY protein |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0007275 | Biological Process | multicellular organism development | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 68 aa Download sequence Send to blast |
MSSCSVDVAP EQLCYIPCNF CNIVLAVSVP CSSLFDIVTV RCGHCTNLWS VNMAAAFQSL 60 SWQQDHHX |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Promotes adaxial cell identity. Regulates the initiation of embryonic shoot apical meristem (SAM) development. {ECO:0000269|PubMed:19837869}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT090216 | 2e-65 | BT090216.1 Soybean clone JCVI-FLGm-3N14 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010105229.1 | 6e-40 | axial regulator YABBY 5 | ||||
| Swissprot | Q8GW46 | 3e-30 | YAB5_ARATH; Axial regulator YABBY 5 | ||||
| TrEMBL | A0A2P5EU47 | 7e-42 | A0A2P5EU47_TREOI; YABBY protein | ||||
| STRING | XP_010105229.1 | 2e-39 | (Morus notabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1124 | 34 | 112 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G26580.2 | 1e-32 | YABBY family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




