![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PK10122.6 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 110aa MW: 12144 Da PI: 11.0161 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 60.4 | 2.2e-19 | 30 | 64 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +l
PK10122.6 30 CSHCGVQKTPQWRTGPLGAKTLCNACGVRFKSGRL 64
*******************************9986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF57716 | 5.7E-15 | 23 | 86 | No hit | No description |
| PROSITE profile | PS50114 | 11.886 | 24 | 60 | IPR000679 | Zinc finger, GATA-type |
| SMART | SM00401 | 1.1E-15 | 24 | 78 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 3.1E-15 | 28 | 62 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 1.50E-12 | 29 | 77 | No hit | No description |
| PROSITE pattern | PS00344 | 0 | 30 | 55 | IPR000679 | Zinc finger, GATA-type |
| Pfam | PF00320 | 3.1E-17 | 30 | 64 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 110 aa Download sequence Send to blast |
KKPKKKLTQV GHATNPANPT NPAGQPSRRC SHCGVQKTPQ WRTGPLGAKT LCNACGVRFK 60 SGRLLPEYRP ACSPTFSSEL HSNHHRKVLE MRRKKEDVPV AESGFVVPSF |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001242253.2 | 2e-47 | GATA transcription factor 5-like | ||||
| Refseq | XP_004512096.1 | 3e-47 | GATA transcription factor 5 | ||||
| Refseq | XP_019422188.1 | 2e-47 | PREDICTED: GATA transcription factor 5-like | ||||
| Swissprot | Q9FH57 | 1e-45 | GATA5_ARATH; GATA transcription factor 5 | ||||
| TrEMBL | A0A2P5FNY2 | 1e-49 | A0A2P5FNY2_TREOI; GATA transcription factor | ||||
| STRING | XP_004512096.1 | 1e-46 | (Cicer arietinum) | ||||
| STRING | GLYMA01G37450.1 | 7e-47 | (Glycine max) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1108 | 34 | 107 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G66320.2 | 5e-48 | GATA transcription factor 5 | ||||




