PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PK10271.2

Organism

Cannabis sativa

Taxonomic ID

3483

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis

Family

NAC

Protein Properties

Length: 165aa MW: 19172.7 Da PI: 8.0127

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PK10271.2	genome	CCBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	68.3	2.2e-21	3	52	80	129
NAM 80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 +g+Wkatg+dk++++++++ +g++ktLvfy+grap+g+ktdW+mheyrle PK10271.2 3 AGFWKATGRDKAIHVSDTKRIGMRKTLVFYTGRAPHGQKTDWIMHEYRLE 52 79**********************************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	29.859	1	78	IPR003441	NAC domain
Pfam	PF02365	6.3E-10	3	51	IPR003441	NAC domain
SuperFamily	SSF101941	1.83E-25	3	78	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 165 aa Download sequence Send to blast
XAAGFWKATG RDKAIHVSDT KRIGMRKTLV FYTGRAPHGQ KTDWIMHEYR LEDNDTTTAA 60 PADQIQEDGW VVCRVFKKKN HNRSFQPELG NNNNNNQEEL SYHPQMKTSI NGNSTPLVLD 120 HHHHQHLHHQ HHQPKHFQQL YDNYTFDHHG SMQLPQLFSP ESGAX

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	1e-19	2	80	94	167	NO APICAL MERISTEM PROTEIN
1ut4_B	1e-19	2	80	94	167	NO APICAL MERISTEM PROTEIN
1ut7_A	1e-19	2	80	94	167	NO APICAL MERISTEM PROTEIN
1ut7_B	1e-19	2	80	94	167	NO APICAL MERISTEM PROTEIN
3swm_A	1e-19	2	80	97	170	NAC domain-containing protein 19
3swm_B	1e-19	2	80	97	170	NAC domain-containing protein 19
3swm_C	1e-19	2	80	97	170	NAC domain-containing protein 19
3swm_D	1e-19	2	80	97	170	NAC domain-containing protein 19
3swp_A	1e-19	2	80	97	170	NAC domain-containing protein 19
3swp_B	1e-19	2	80	97	170	NAC domain-containing protein 19
3swp_C	1e-19	2	80	97	170	NAC domain-containing protein 19
3swp_D	1e-19	2	80	97	170	NAC domain-containing protein 19
4dul_A	1e-19	2	80	94	167	NAC domain-containing protein 19
4dul_B	1e-19	2	80	94	167	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription regulator. Together with BRN1 and BRN2, regulates cellular maturation of root cap. Represses stem cell-like divisions in the root cap daughter cells, and thus promotes daughter cell fate. Inhibits expression of its positive regulator FEZ in a feedback loop for controlled switches in cell division plane. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269\|PubMed:19081078, ECO:0000269\|PubMed:20197506}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By FEZ in oriented-divised root cap stem cells. {ECO:0000269\|PubMed:19081078}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015040	8e-33	AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020418176.1	1e-62	protein SOMBRERO isoform X2
Swissprot	Q9MA17	3e-43	SMB_ARATH; Protein SOMBRERO
TrEMBL	A0A2P5B601	3e-77	A0A2P5B601_TREOI; NAC domain containing protein
STRING	XP_009368592.1	1e-60	(Pyrus x bretschneideri)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF7204	34	47

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G79580.3	2e-43	NAC family protein

Publications ? help Back to Top
Fendrych M, et al. Programmed cell death controlled by ANAC033/SOMBRERO determines root cap organ size in Arabidopsis. Curr. Biol., 2014. 24(9): p. 931-40 [PMID:24726156] Bennett T,van den Toorn A,Willemsen V,Scheres B Precise control of plant stem cell activity through parallel regulatory inputs. Development, 2014. 141(21): p. 4055-64 [PMID:25256342] Karve R,Suárez-Román F,Iyer-Pascuzzi AS The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release. Plant Physiol., 2016. 171(3): p. 2101-11 [PMID:27221617] Kamiya M, et al. Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis. Development, 2016. 143(21): p. 4063-4072 [PMID:27803060]