![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PK11198.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 82aa MW: 9563.23 Da PI: 4.042 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 33.9 | 7e-11 | 37 | 76 | 3 | 44 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44
++++E+ l+++ +++ G + W++Ia +++ gRt++++ +w
PK11198.1 37 EFSEDEESLIIRMFNLIGER-WSLIAGRIP-GRTAEEIEKYW 76
69******************.*********.*********** PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 10.037 | 30 | 82 | IPR017930 | Myb domain |
| SMART | SM00717 | 2.0E-7 | 34 | 82 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.20E-7 | 37 | 76 | No hit | No description |
| Pfam | PF00249 | 5.2E-10 | 37 | 77 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 4.99E-9 | 37 | 79 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 2.3E-13 | 37 | 78 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 82 aa Download sequence Send to blast |
MADSEHSSCD DNFAHSQAEE EEVMSEESIR REVVEVEFSE DEESLIIRMF NLIGERWSLI 60 AGRIPGRTAE EIEKYWVSKY SX |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024024718.1 | 4e-33 | MYB-like transcription factor ETC1 | ||||
| Refseq | XP_024024719.1 | 4e-33 | MYB-like transcription factor ETC1 | ||||
| Swissprot | Q9LNI5 | 2e-16 | ETC1_ARATH; MYB-like transcription factor ETC1 | ||||
| TrEMBL | A0A2P5EIH6 | 2e-28 | A0A2P5EIH6_TREOI; GAMYB transcription factor | ||||
| TrEMBL | B9HZL8 | 2e-28 | B9HZL8_POPTR; Uncharacterized protein | ||||
| STRING | POPTR_0011s00390.1 | 4e-29 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2692 | 31 | 78 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G01380.1 | 2e-16 | MYB_related family protein | ||||




