PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PK13838.1

Organism

Cannabis sativa

Taxonomic ID

3483

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis

Family

YABBY

Protein Properties

Length: 173aa MW: 19227.9 Da PI: 9.7519

Description

YABBY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PK13838.1	genome	CCBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	YABBY	151.7	6.9e-47	3	154	3	163
YABBY 3 vfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvssekls 102 + s+++Cyv+CnfC+t+lav++P++ + +vtv+CGhC++l + +++ ++ + h ++ ++ + + ++ + ++ s+s s +s++ s PK13838.1 3 FTPPSDHLCYVRCNFCTTVLAVALPYKRFLDTVTVKCGHCSNLSFL--STR--PTPLQPH---QFLDQ-YPLMTHLPGFCNNDHLRKGSSSGSSPSSTTS 94 56789**********************************98653..333..3444444...33332.1222223333444455555555555655544 PP YABBY 103 enedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163 + ++ +p v++PPek+ r Psaynrf+keeiqrik++nP+i hreafsaaaknWa + PK13838.1 95 GDPMSST-GAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKSANPEIPHREAFSAAAKNWARY 154 4444444.46789********************************************75 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04690	1.9E-52	6	154	IPR006780	YABBY protein
SuperFamily	SSF47095	2.09E-8	100	152	IPR009071	High mobility group box domain
Gene3D	G3DSA:1.10.30.10	3.8E-5	108	153	IPR009071	High mobility group box domain
CDD	cd01390	6.35E-6	115	151	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0010254	Biological Process	nectary development
GO:0010582	Biological Process	floral meristem determinacy
GO:0048479	Biological Process	style development

Sequence ? help Back to Top
Protein Sequence Length: 173 aa Download sequence Send to blast
MEFTPPSDHL CYVRCNFCTT VLAVALPYKR FLDTVTVKCG HCSNLSFLST RPTPLQPHQF 60 LDQYPLMTHL PGFCNNDHLR KGSSSGSSPS STTSGDPMSS TGAPFVVKPP EKKHRLPSAY 120 NRFMKEEIQR IKSANPEIPH REAFSAAAKN WARYIPHPPA GSVSGSNKRI LQQ

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for the initiation of nectary development. Also involved in suppressing early radial growth of the gynoecium, in promoting its later elongation and in fusion of its carpels by regulating both cell division and expansion. Establishes the polar differentiation in the carpels by specifying abaxial cell fate in the ovary wall. Regulates both cell division and expansion. {ECO:0000269\|PubMed:10225997, ECO:0000269\|PubMed:10225998, ECO:0000269\|PubMed:10535738, ECO:0000269\|PubMed:11714690, ECO:0000269\|PubMed:15598802, ECO:0000269\|Ref.10}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00220	DAP	Transfer from AT1G69180	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by SPT and by A class genes AP2 and LUG in the outer whorl. In the third whorl, B class genes AP3 and PI, and the C class gene AG act redundantly with each other and in combination with SEP1, SEP2, SEP3, SHP1 and SHP2 to activate CRC in nectaries and carpels. LFY enhances its expression. {ECO:0000269\|PubMed:10225998, ECO:0000269\|PubMed:15598802}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024018325.1	1e-79	protein CRABS CLAW
Swissprot	Q8L925	3e-57	CRC_ARATH; Protein CRABS CLAW
TrEMBL	A0A2P5E2G7	3e-83	A0A2P5E2G7_PARAD; YABBY protein
STRING	XP_004509753.1	4e-72	(Cicer arietinum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF10259	30	40

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69180.1	2e-58	YABBY family protein

Publications ? help Back to Top
Fourquin C,Primo A,Martínez-Fernández I,Huet-Trujillo E,Ferrándiz C The CRC orthologue from Pisum sativum shows conserved functions in carpel morphogenesis and vascular development. Ann. Bot., 2014. 114(7): p. 1535-44 [PMID:24989787] Pfannebecker KC,Lange M,Rupp O,Becker A Seed Plant-Specific Gene Lineages Involved in Carpel Development. Mol. Biol. Evol., 2017. 34(4): p. 925-942 [PMID:28087776] Yamaguchi N,Huang J,Xu Y,Tanoi K,Ito T Fine-tuning of auxin homeostasis governs the transition from floral stem cell maintenance to gynoecium formation. Nat Commun, 2017. 8(1): p. 1125 [PMID:29066759] Yamaguchi N, et al. Chromatin-mediated feed-forward auxin biosynthesis in floral meristem determinacy. Nat Commun, 2018. 9(1): p. 5290 [PMID:30538233]