| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 50.6 | 4.6e-16 | 8 | 55 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g W++eEde+l ++ + G g+W+ Iar g+ R++k+c++rw +yl
PK14287.1 8 KGLWSPEEDEKLMRYMLRNGQGCWSDIARNAGLQRCGKSCRLRWINYL 55
678*******************************************97 PP
|
| 2 | Myb_DNA-binding | 47.3 | 4.7e-15 | 61 | 105 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
rg+++ E++l+++++ lG++ W+ Ia++++ gRt++++k++w++
PK14287.1 61 RGAFSSHEQDLILHLHSILGNR-WSQIAARLP-GRTDNEIKNFWNST 105
89********************.*********.***********986 PP
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription activator. Involved in the regulation of secondary wall biosynthesis in fibers and vessels (PubMed:17890373). Transcription activator of the mannan synthase CSLA9 that recognizes and binds to the DNA consensus sequence 5'-[AG][GT]T[AT]GGT[GA]-3' cis-regulatory element of CSLA9 promoter (PubMed:24243147). Transcription factor that acts as molecular switch in the NAC012/SND1-mediated transcriptional network regulating secondary wall biosynthesis. Is directly activated by NAC012/SND1. Functions redundantly with MYB83 in the transcriptional regulatory cascade leading to secondary wall formation in fibers and vessels (PubMed:19808805). Transcription activator that binds to the DNA consensus sequence 5'-ACC[AT]A[AC][TC]-3', designated as the secondary wall MYB-responsive element (SMRE). Regulates directly numerous transcription factors and a number of genes involved in secondary wall biosynthesis that contain SMRE elements in their promoters (PubMed:22197883). Is an obligate component of the transcriptional regulatory complex toward the commitment of secondary wall cellulose synthesis. Is required for functional expression of the three secondary wall CESA genes, CESA4, CESA7 and CESA8 (PubMed:23726771). {ECO:0000269|PubMed:17890373, ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:22197883, ECO:0000269|PubMed:23726771, ECO:0000269|PubMed:24243147}. |
| UniProt | Transcription factor that acts as molecular switch in the NAC012/SND1-mediated transcriptional network regulating secondary wall biosynthesis. Is directly activated by NAC012/SND1 and its close homologs, including NAC043/NST1, NAC066/NST2, NAC101/VND6 and NAC030/VND7. Is required for functional expression of a number of secondary wall-associated transcription factors and secondary wall biosynthetic genes involved in cellulose, xylan and lignin synthesis. Functions redundantly with MYB46 in the transcriptional regulatory cascade leading to secondary wall formation in fibers and vessels (PubMed:19808805). Transcription activator that binds to the DNA consensus sequence 5'-ACC[AT]A[AC][TC]-3', designated as the secondary wall MYB-responsive element (SMRE). Regulates directly numerous transcription factors and a number of genes involved in secondary wall biosynthesis that contain SMRE elements in their promoters (PubMed:22197883). {ECO:0000269|PubMed:19808805, ECO:0000269|PubMed:22197883}. |