![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PK16035.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 90aa MW: 10239 Da PI: 10.1567 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 98.9 | 3.1e-31 | 2 | 55 | 5 | 59 |
S-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 5 ynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
ynWrKYGqK+vkgse+prsYY+Ct+++C+vkkkvers+ d++++ei+Y+++Hnh
PK16035.2 2 YNWRKYGQKQVKGSEYPRSYYKCTHPNCQVKKKVERSH-DGQITEIIYKSNHNHA 55
9*************************************.***************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50811 | 22.389 | 1 | 57 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 6.9E-26 | 2 | 57 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 2.22E-23 | 2 | 57 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.0E-23 | 2 | 54 | IPR003657 | WRKY domain |
| SMART | SM00774 | 2.3E-29 | 2 | 56 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 90 aa Download sequence Send to blast |
XYNWRKYGQK QVKGSEYPRS YYKCTHPNCQ VKKKVERSHD GQITEIIYKS NHNHAKPQPN 60 RRAGVGSSAA ALFFDEMLEL SGGTGISVKX |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 2ayd_A | 9e-18 | 2 | 57 | 18 | 74 | WRKY transcription factor 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. {ECO:0000250|UniProtKB:Q9SI37}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_015875770.1 | 1e-41 | WRKY transcription factor SUSIBA2-like | ||||
| Swissprot | O65590 | 3e-32 | WRK34_ARATH; Probable WRKY transcription factor 34 | ||||
| TrEMBL | A0A2P5C280 | 7e-41 | A0A2P5C280_TREOI; WRKY domain containing protein | ||||
| TrEMBL | A0A2P5CUG5 | 8e-41 | A0A2P5CUG5_PARAD; WRKY domain containing protein | ||||
| TrEMBL | A0A386IPD1 | 2e-42 | A0A386IPD1_ZIZJJ; WRKY transcription factor 64 | ||||
| STRING | XP_010111075.1 | 4e-39 | (Morus notabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF19281 | 4 | 5 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G26640.1 | 1e-34 | WRKY family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




