![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PK17295.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 91aa MW: 11109.7 Da PI: 8.4302 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 95.6 | 7.5e-30 | 15 | 91 | 1 | 78 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknrat 78
+ pGfrFhPtdeelv +yLk+k+++++l++ e ik++diyk++PwdLpk ++++ekewyf+++rd+ky++++r+nr+t
PK17295.1 15 MLPGFRFHPTDEELVGFYLKRKIQQRPLSI-ELIKQLDIYKYDPWDLPKLASTGEKEWYFYCPRDRKYRNSTRPNRVT 91
579***************************.89***************9888999*********************86 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 8.24E-31 | 13 | 91 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 30.741 | 15 | 91 | IPR003441 | NAC domain |
| Pfam | PF02365 | 4.1E-13 | 17 | 82 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 91 aa Download sequence Send to blast |
MDHERSEGDK LEEVMLPGFR FHPTDEELVG FYLKRKIQQR PLSIELIKQL DIYKYDPWDL 60 PKLASTGEKE WYFYCPRDRK YRNSTRPNRV T |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 4e-28 | 7 | 91 | 8 | 93 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 4e-28 | 7 | 91 | 8 | 93 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 4e-28 | 7 | 91 | 8 | 93 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 4e-28 | 7 | 91 | 8 | 93 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 5e-28 | 7 | 91 | 11 | 96 | NAC domain-containing protein 19 |
| 3swm_B | 5e-28 | 7 | 91 | 11 | 96 | NAC domain-containing protein 19 |
| 3swm_C | 5e-28 | 7 | 91 | 11 | 96 | NAC domain-containing protein 19 |
| 3swm_D | 5e-28 | 7 | 91 | 11 | 96 | NAC domain-containing protein 19 |
| 3swp_A | 5e-28 | 7 | 91 | 11 | 96 | NAC domain-containing protein 19 |
| 3swp_B | 5e-28 | 7 | 91 | 11 | 96 | NAC domain-containing protein 19 |
| 3swp_C | 5e-28 | 7 | 91 | 11 | 96 | NAC domain-containing protein 19 |
| 3swp_D | 5e-28 | 7 | 91 | 11 | 96 | NAC domain-containing protein 19 |
| 4dul_A | 4e-28 | 7 | 91 | 8 | 93 | NAC domain-containing protein 19 |
| 4dul_B | 4e-28 | 7 | 91 | 8 | 93 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Promotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269|PubMed:19081078}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269|PubMed:19081078}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002522427.1 | 6e-56 | protein FEZ | ||||
| Refseq | XP_017222468.1 | 3e-56 | PREDICTED: protein FEZ-like | ||||
| Swissprot | Q9ZVH0 | 8e-49 | FEZ_ARATH; Protein FEZ | ||||
| TrEMBL | A0A2P5C967 | 1e-55 | A0A2P5C967_PARAD; NAC domain containing protein | ||||
| STRING | XP_002522427.1 | 2e-55 | (Ricinus communis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2013 | 34 | 90 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G26870.1 | 3e-51 | NAC family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




