![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PK17504.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 61aa MW: 7046.89 Da PI: 9.9525 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 62.9 | 6.6e-20 | 9 | 56 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd++lv+ +++ G g+W++ +r g++R++k+c++rw +yl
PK17504.1 9 KGPWTPEEDQKLVKFIQKNGHGSWRALPRLAGLNRCGKSCRLRWTNYL 56
79********************************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 24.445 | 4 | 60 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 5.1E-18 | 5 | 60 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 3.3E-24 | 7 | 59 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 6.0E-15 | 8 | 58 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 2.4E-18 | 9 | 56 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 2.61E-11 | 11 | 56 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 61 aa Download sequence Send to blast |
CCDESGLKKG PWTPEEDQKL VKFIQKNGHG SWRALPRLAG LNRCGKSCRL RWTNYLRPDI 60 X |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269|PubMed:24902892}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269|PubMed:24902892}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012064723.1 | 6e-39 | myb-related protein 330 | ||||
| Swissprot | Q9S9Z2 | 9e-36 | MYB93_ARATH; Transcription factor MYB93 | ||||
| TrEMBL | A0A067LQI0 | 1e-37 | A0A067LQI0_JATCU; MYB family protein | ||||
| STRING | XP_010087606.1 | 7e-38 | (Morus notabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF31 | 34 | 817 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G34670.1 | 4e-38 | myb domain protein 93 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




