PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PK18009.1

Organism

Cannabis sativa

Taxonomic ID

3483

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis

Family

bZIP

Protein Properties

Length: 279aa MW: 30577.5 Da PI: 11.0941

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PK18009.1	genome	CCBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	45.8	1.3e-14	202	252	5	55
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 +r rr++kNRe+A rsR+RK+a++ eLe ++++L++ N++L k+ ee+ ++ PK18009.1 202 RRHRRMIKNRESAARSRARKQAYTLELEAEIAKLKEVNEELLKKQEEYMEM 252 689****************************************99999987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	2.4E-10	197	263	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.105	200	251	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	1.2E-12	202	253	IPR004827	Basic-leucine zipper domain
Gene3D	G3DSA:1.20.5.170	3.3E-13	202	251	No hit	No description
CDD	cd14707	3.97E-26	202	256	No hit	No description
SuperFamily	SSF57959	1.62E-10	202	252	No hit	No description
PROSITE pattern	PS00036	0	205	220	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 279 aa Download sequence Send to blast
XANANANANA NANALAFGFQ QPSRNNGLVD NRMPTMTNPT TNRPLNLPIN NGGVRSSQQV 60 QMQQQQLQQQ QLKPQQQQQQ QPLYPKPATL AFTPPMHLVS NAQLTSPATR ETIVGVNEPA 120 VSSALVQARG LQQGRGGINS MANVGAATGT VTVGTRSPAN HISSNVVAKA SAVDSPSVSP 180 PVPYMFSRGG KCGPGLEKVI ERRHRRMIKN RESAARSRAR KQAYTLELEA EIAKLKEVNE 240 ELLKKQEEYM EMQKVQMLET MNGWGNKRQC LRRTLTGPW

Functional Description ? help Back to Top
Source	Description
UniProt	Binds to the ABA-responsive element (ABRE). Mediates stress-responsive ABA signaling. {ECO:0000269\|PubMed:11884679, ECO:0000269\|PubMed:15361142}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by drought, salt, abscisic acid (ABA). {ECO:0000269\|PubMed:10636868, ECO:0000269\|PubMed:16284313}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024028907.1	2e-96	bZIP transcription factor 46
Swissprot	Q9M7Q3	2e-48	AI5L6_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 6
TrEMBL	A0A2P5E927	1e-124	A0A2P5E927_TREOI; Basic-leucine zipper transcription factor
STRING	XP_004294799.1	6e-87	(Fragaria vesca)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1962	34	81

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G34000.2	6e-27	abscisic acid responsive elements-binding factor 3

Publications ? help Back to Top
Zhao Q, et al. Regulation and function of Arabidopsis AtGALK2 gene in abscisic acid response signaling. Mol. Biol. Rep., 2018. [PMID:24078097] Bao Y, et al. The tumor necrosis factor receptor-associated factor (TRAF)-like family protein SEVEN IN ABSENTIA 2 (SINA2) promotes drought tolerance in an ABA-dependent manner in Arabidopsis. New Phytol., 2014. 202(1): p. 174-87 [PMID:24350984] González-Grandío E,Cubas P Identification of gene functions associated to active and dormant buds in Arabidopsis. Plant Signal Behav, 2014. 9(2): p. e27994 [PMID:24518068] Xie M, et al. AtWNK9 is regulated by ABA and dehydration and is involved in drought tolerance in Arabidopsis. Plant Physiol. Biochem., 2014. 77: p. 73-83 [PMID:24561249] Kim EY,Seo YS,Park KY,Kim SJ,Kim WT Overexpression of CaDSR6 increases tolerance to drought and salt stresses in transgenic Arabidopsis plants. Gene, 2014. 552(1): p. 146-54 [PMID:25234727] Zhang H, et al. The RING finger ubiquitin E3 ligase SDIR1 targets SDIR1-INTERACTING PROTEIN1 for degradation to modulate the salt stress response and ABA signaling in Arabidopsis. Plant Cell, 2015. 27(1): p. 214-27 [PMID:25616872] Baek D, et al. A Role for Arabidopsis miR399f in Salt, Drought, and ABA Signaling. Mol. Cells, 2016. 39(2): p. 111-8 [PMID:26674968] Bao Y, et al. Overexpression of the NDR1/HIN1-Like Gene NHL6 Modifies Seed Germination in Response to Abscisic Acid and Abiotic Stresses in Arabidopsis. PLoS ONE, 2016. 11(2): p. e0148572 [PMID:26849212] Gao S, et al. ABF2, ABF3, and ABF4 Promote ABA-Mediated Chlorophyll Degradation and Leaf Senescence by Transcriptional Activation of Chlorophyll Catabolic Genes and Senescence-Associated Genes in Arabidopsis. Mol Plant, 2016. 9(9): p. 1272-1285 [PMID:27373216] Li X, et al. Dual Function of NAC072 in ABF3-Mediated ABA-Responsive Gene Regulation in Arabidopsis. Front Plant Sci, 2016. 7: p. 1075 [PMID:27486475] Wang Z, et al. Overexpressing Arabidopsis ABF3 increases tolerance to multiple abiotic stresses and reduces leaf size in alfalfa. Plant Physiol. Biochem., 2016. 109: p. 199-208 [PMID:27721135] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239] Kerr TCC, et al. Ectopic expression of two AREB/ABF orthologs increases drought tolerance in cotton (Gossypium hirsutum). Plant Cell Environ., 2018. 41(5): p. 898-907 [PMID:28098349] Lyzenga WJ,Sullivan V,Liu H,Stone SL The Kinase Activity of Calcineurin B-like Interacting Protein Kinase 26 (CIPK26) Influences Its Own Stability and that of the ABA-regulated Ubiquitin Ligase, Keep on Going (KEG). Front Plant Sci, 2017. 8: p. 502 [PMID:28443108] Song C,Kim T,Chung WS,Lim CO The Arabidopsis Phytocystatin AtCYS5 Enhances Seed Germination and Seedling Growth under Heat Stress Conditions. Mol. Cells, 2017. 40(8): p. 577-586 [PMID:28756655] Fernando VCD,Al Khateeb W,Belmonte MF,Schroeder DF Role of Arabidopsis ABF1/3/4 during det1 germination in salt and osmotic stress conditions. Plant Mol. Biol., 2018. 97(1-2): p. 149-163 [PMID:29680877] Kim HJ, et al. Confirmation of Drought Tolerance of Ectopically Expressed AtABF3 Gene in Soybean. Mol. Cells, 2018. 41(5): p. 413-422 [PMID:29754472]