![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PK20247.2 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
| Family | Whirly | ||||||||
| Protein Properties | Length: 83aa MW: 9241.55 Da PI: 8.6149 | ||||||||
| Description | Whirly family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Whirly | 67.4 | 2.6e-21 | 9 | 69 | 2 | 62 |
Whirly 2 vyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatev 62
vyk+kaa++v +v+ptf++ldsg +++r G ++l++++a++erkydWek+q+ l +t
PK20247.2 9 VYKGKAAFSVTPVLPTFTKLDSGLHVVDRGGCMMLKFTPAIGERKYDWEKRQVSDLYSTCY 69
8***************************************************999988865 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.30.31.10 | 2.2E-22 | 5 | 67 | IPR009044 | ssDNA-binding transcriptional regulator |
| SuperFamily | SSF54447 | 2.43E-19 | 5 | 64 | IPR009044 | ssDNA-binding transcriptional regulator |
| Pfam | PF08536 | 1.2E-19 | 9 | 67 | IPR013742 | Plant transcription factor |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 83 aa Download sequence Send to blast |
XGFSAPYIVY KGKAAFSVTP VLPTFTKLDS GLHVVDRGGC MMLKFTPAIG ERKYDWEKRQ 60 VSDLYSTCYS LIVCCLIAKS DYA |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4kop_A | 1e-22 | 5 | 60 | 13 | 68 | Single-stranded DNA-binding protein WHY2, mitochondrial |
| 4kop_B | 1e-22 | 5 | 60 | 13 | 68 | Single-stranded DNA-binding protein WHY2, mitochondrial |
| 4kop_C | 1e-22 | 5 | 60 | 13 | 68 | Single-stranded DNA-binding protein WHY2, mitochondrial |
| 4kop_D | 1e-22 | 5 | 60 | 13 | 68 | Single-stranded DNA-binding protein WHY2, mitochondrial |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Single-stranded DNA-binding protein that associates with mitochondrial DNA and may play a role in the regulation of the gene expression machinery. Seems also to be required to prevent break-induced DNA rearrangements in the mitochondrial genome. Can bind to melt double-stranded DNA in vivo. {ECO:0000269|PubMed:18423020, ECO:0000269|PubMed:20551348, ECO:0000269|PubMed:22762281}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024031621.1 | 6e-29 | single-stranded DNA-binding protein WHY2, mitochondrial | ||||
| Swissprot | Q8VYF7 | 6e-22 | WHY2_ARATH; Single-stranded DNA-binding protein WHY2, mitochondrial | ||||
| TrEMBL | A0A2P5AEC0 | 3e-28 | A0A2P5AEC0_PARAD; Transcription factor | ||||
| STRING | XP_010112062.1 | 2e-27 | (Morus notabilis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF11383 | 33 | 38 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G71260.1 | 3e-24 | WHIRLY 2 | ||||




