PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PK22028.1

Organism

Cannabis sativa

Taxonomic ID

3483

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis

Family

HSF

Protein Properties

Length: 183aa MW: 19705.6 Da PI: 4.0052

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PK22028.1	genome	CCBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	76.3	5.4e-24	115	173	2	60
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60 Fl+k+y++++d++l+ +isw ++g sfvv+d+ ef++ +Lp+ Fkh+nf+SFvRQLn+Y PK22028.1 115 FLSKTYDLVDDPALDPIISWGSTGGSFVVWDPVEFSRIILPRNFKHNNFSSFVRQLNTY 173 9********************************************************** PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	6.1E-25	110	174	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	6.2E-21	111	181	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	1.85E-23	113	173	IPR011991	Winged helix-turn-helix DNA-binding domain
PRINTS	PR00056	1.4E-14	115	138	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Pfam	PF00447	9.6E-20	115	173	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.4E-14	153	165	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	1.4E-14	166	178	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 183 aa Download sequence Send to blast
MNPNDESSSP DSSSKMSETL ETQPFLSDSF FVEEGVGFSG SHSPASFAFS PLPIPFSSSP 60 VFEFESGIPV GERAQTVPSS STGGEAGALV TVTGTEFVEV PRPLECLQGN PIPPFLSKTY 120 DLVDDPALDP IISWGSTGGS FVVWDPVEFS RIILPRNFKH NNFSSFVRQL NTYVGNLITQ 180 SVX

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2ldu_A	1e-16	112	173	17	78	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). Involved in heat stress response. Activated by DREB2A under heat stress. {ECO:0000269\|PubMed:17999647, ECO:0000269\|PubMed:18261981}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By heat stress. {ECO:0000269\|PubMed:17999647, ECO:0000269\|PubMed:18261981}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015898712.1	9e-51	heat stress transcription factor A-3
Refseq	XP_024922346.1	9e-51	heat stress transcription factor A-3
Swissprot	Q8GYY1	6e-40	HSFA3_ARATH; Heat stress transcription factor A-3
TrEMBL	A0A2P5BVZ0	3e-61	A0A2P5BVZ0_TREOI; Heat shock transcription factor
STRING	evm.model.supercontig_5.77	2e-48	(Carica papaya)
STRING	XP_008386939.1	2e-48	(Malus domestica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1592	33	95

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G03720.1	3e-42	heat shock transcription factor A3

Publications ? help Back to Top
Jung HS, et al. Subset of heat-shock transcription factors required for the early response of Arabidopsis to excess light. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(35): p. 14474-9 [PMID:23918368] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Nie S,Yue H,Xing D A Potential Role for Mitochondrial Produced Reactive Oxygen Species in Salicylic Acid-Mediated Plant Acquired Thermotolerance. Plant Physiol., 2016. [PMID:26099269] Hu Z, et al. Histone acetyltransferase GCN5 is essential for heat stress-responsive gene activation and thermotolerance in Arabidopsis. Plant J., 2015. 84(6): p. 1178-91 [PMID:26576681] Song C,Chung WS,Lim CO Overexpression of Heat Shock Factor Gene HsfA3 Increases Galactinol Levels and Oxidative Stress Tolerance in Arabidopsis. Mol. Cells, 2016. 39(6): p. 477-83 [PMID:27109422] Kim GD,Cho YH,Lee BH,Yoo SD STABILIZED1 Modulates Pre-mRNA Splicing for Thermotolerance. Plant Physiol., 2017. 173(4): p. 2370-2382 [PMID:28223317] Song C,Lee J,Kim T,Hong JC,Lim CO VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis. Planta, 2018. 247(6): p. 1439-1448 [PMID:29536220]