![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | PK22221.1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 74aa MW: 8871.11 Da PI: 11.2278 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 101.6 | 1.1e-31 | 3 | 74 | 55 | 127 |
NAM 55 ekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk + + +++g++ktLvfy+grap+g+k+dW+mheyr
PK22221.1 3 QSEWYFFSHKDRKYPTGSRTNRATNAGFWKATGRDKCIRN-AFKKIGMRKTLVFYRGRAPHGQKSDWIMHEYR 74
579************************************9.8899***************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 34.846 | 1 | 74 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 2.62E-30 | 3 | 74 | IPR003441 | NAC domain |
| Pfam | PF02365 | 5.5E-16 | 6 | 74 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 74 aa Download sequence Send to blast |
TPQSEWYFFS HKDRKYPTGS RTNRATNAGF WKATGRDKCI RNAFKKIGMR KTLVFYRGRA 60 PHGQKSDWIM HEYR |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3swm_A | 5e-28 | 3 | 74 | 73 | 144 | NAC domain-containing protein 19 |
| 3swm_B | 5e-28 | 3 | 74 | 73 | 144 | NAC domain-containing protein 19 |
| 3swm_C | 5e-28 | 3 | 74 | 73 | 144 | NAC domain-containing protein 19 |
| 3swm_D | 5e-28 | 3 | 74 | 73 | 144 | NAC domain-containing protein 19 |
| 3swp_A | 5e-28 | 3 | 74 | 73 | 144 | NAC domain-containing protein 19 |
| 3swp_B | 5e-28 | 3 | 74 | 73 | 144 | NAC domain-containing protein 19 |
| 3swp_C | 5e-28 | 3 | 74 | 73 | 144 | NAC domain-containing protein 19 |
| 3swp_D | 5e-28 | 3 | 74 | 73 | 144 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator. Together with BRN1 and SMB, regulates cellular maturation of root cap. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269|PubMed:20197506}. | |||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009757635.1 | 1e-48 | PREDICTED: protein BEARSKIN1 | ||||
| Refseq | XP_016556495.1 | 1e-47 | PREDICTED: protein BEARSKIN2 | ||||
| Swissprot | Q9SV87 | 2e-46 | BRN2_ARATH; Protein BEARSKIN2 | ||||
| TrEMBL | A0A067E845 | 2e-46 | A0A067E845_CITSI; Uncharacterized protein (Fragment) | ||||
| TrEMBL | A0A1U7V7B1 | 3e-47 | A0A1U7V7B1_NICSY; protein BEARSKIN1 | ||||
| TrEMBL | A0A1U8FL53 | 2e-46 | A0A1U8FL53_CAPAN; protein BEARSKIN2 | ||||
| TrEMBL | A0A2G3AIX3 | 2e-46 | A0A2G3AIX3_CAPAN; Protein BEARSKIN2 | ||||
| TrEMBL | A0A2G3DGI5 | 2e-46 | A0A2G3DGI5_CAPCH; Protein BEARSKIN2 | ||||
| TrEMBL | A0A438CA78 | 2e-46 | A0A438CA78_VITVI; Protein BEARSKIN2 | ||||
| STRING | Lus10013782 | 1e-46 | (Linum usitatissimum) | ||||
| STRING | Solyc06g063430.1.1 | 5e-47 | (Solanum lycopersicum) | ||||
| STRING | XP_009757635.1 | 5e-48 | (Nicotiana sylvestris) | ||||
| STRING | XP_009761820.1 | 4e-47 | (Nicotiana sylvestris) | ||||
| STRING | XP_009602081.1 | 8e-47 | (Nicotiana tomentosiformis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF8752 | 33 | 43 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G10350.1 | 6e-49 | NAC domain containing protein 70 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




